KEGG   Colwellia psychrerythraea: CPS_0898Help
Entry
CPS_0898          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ26908
UniProt: Q487W8
Position
complement(899673..900353)
Genome map
AA seq 226 aa AA seqDB search
MKAYRSLSTRIKFMNKPSKVVFFTDMDKVKNSEVKSFATKKSYHVSINSISTSVYETERN
SWNESLLKICSYCEDKKELANQSNHFNDLLDFMANLAIEKSVHNRVLEDARNAFLTYYED
NKTNQLNKFPEPSVDSLMQLVRFIPEISRLKHNVYIDENTGAFGLTLKSSKKSKPILNLL
MKENKEVTFSFIKKGKGIIKITGRAFFNHNLEDSHEIYNLIRMVKS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcttacaggagtttatcaacgaggattaaattcatgaataaaccttcaaaagtt
gtctttttcactgatatggataaagtaaaaaattcagaagtgaaaagtttcgcgactaaa
aaatcttatcatgtcagtataaactctatttctacatccgtttatgaaactgagcgaaat
agctggaatgaatctctactaaaaatttgtagttattgtgaagataagaaagagttggct
aatcaaagtaatcattttaatgatttactagattttatggctaacttagcaatagagaaa
agtgtccacaatagagtgcttgaggatgctcgaaatgcattccttacatattatgaagat
aataaaaccaatcaattaaacaaatttcctgaaccatctgtagattcacttatgcaattg
gtaaggttcattcctgaaattagtagacttaaacataatgtttatattgatgaaaatacc
ggtgcgtttggtttaactttaaaatcgagtaaaaaaagtaagcccatattaaatttatta
atgaaggaaaataaagaggtcacattctcttttataaaaaaaggaaaagggatcataaaa
ataacagggagagcattttttaatcataacttagaggactcccacgaaatatataacctg
atcagaatggtgaaaagttga

DBGET integrated database retrieval system