KEGG   Colwellia psychrerythraea: CPS_0899Help
Entry
CPS_0899          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3467
Motif
Other DBs
NCBI-ProteinID: AAZ25961
UniProt: Q487W7
Position
complement(900319..900525)
Genome map
AA seq 68 aa AA seqDB search
MNEKKFIPRQRAPFVSMGFRLASGDELCIVDFLDLPDDNVTKVETSIAITKNQAKKLIEG
LQEFINED
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagaaaaaatttataccaaggcaaagagccccttttgtttctatggggtttaga
ttagcaagcggagatgagctatgtattgttgatttcctagacctgcctgatgacaatgtt
acaaaagtggaaacttcaatagcgatcacaaagaaccaagcaaagaagttaattgaaggc
ttacaggagtttatcaacgaggattaa

DBGET integrated database retrieval system