KEGG   Colwellia psychrerythraea: CPS_0922Help
Entry
CPS_0922          CDS       T00258                                 

Definition
(RefSeq) major facilitator family transporter
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AAZ26320
UniProt: Q487U4
Position
926822..928186
Genome map
AA seq 454 aa AA seqDB search
MSVSGLNRIEKKAAFSLASVFGVRMLGLFMILPVFAIYGEQLTGYSPIWLGLAIGAYGLT
QALLQIPMGILSDKYGRKPVILAGLVVFLIGSIVAAMSDTIYGVVLGRAIQGMGAIASAI
LALAADLSREEQRPKVMATIGMFIGLSFTFAMILGPIVADAFGLSGLFWFTGLLTTFAMA
MIQFMVPNSVNKAPRGDNVALPEQITRLIRHPQLSRLNWGVFILHMTLTACFITLPKQFV
ASGLSLEDHWQIYLPTLLGSFFLMVPFMIFAIKKQKEKPMFSAAITLLAIALFLLWLLPS
GFWSLVLSVVLFFTAFNYLEATMPSILSRIAPAGVKGSAMGIYSSSQFLGAFVGGILGGF
IASQYGEQTIFLVMTIVTVIWLGLSFGMQSLKKSKSFSFATNITCEEEADKMADQLINMP
GVIEATLVHTEAVAYLKVDVKTVDLLAIKALLQS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtttcaggtttaaaccgtattgagaaaaaagccgccttttccttagccagtgtc
tttggcgtgcgcatgttaggcttgttcatgatcttacccgtattcgccatttatggtgaa
caactaacgggttatagtcccatttggttaggattagccattggtgcctatggattaacg
caagctttattgcaaatccctatgggcattctttcggataaatatggcaggaaaccggta
attcttgccggcttagtggtctttctcatcggtagtattgttgcggcaatgtctgacact
atttatggtgttgtgctcggtcgagcaattcaggggatgggtgctattgctagtgcaata
cttgctttagctgctgatttaagtcgagaagaacagcgacctaaagtcatggcaaccatt
ggtatgtttatcggtttatcatttacctttgctatgattttaggaccaatagttgctgat
gcctttggtttaagtggcttattttggtttacagggctattgactacctttgccatggcg
atgattcaatttatggtgccaaactcagtgaataaagcaccgcgtggcgataacgttgcc
ttgcctgagcaaattactcgtttgattcgccacccacaattatcccgtttaaattggggc
gttttcattctacatatgacactgacggcctgttttattactttgcctaaacagtttgtc
gctagtggtttatctcttgaagaccattggcaaatttacttacctactttattaggttct
ttctttttaatggtgccatttatgatttttgccattaaaaaacagaaagaaaaacccatg
ttcagtgcggctattacactattggccatagctttatttttactttggttattacctagt
ggtttctggagcctagtgctgtcagttgtactatttttcacagcttttaactatttagag
gcaaccatgccgtcaatcttatcacgtatagcacctgctggcgttaaaggtagtgctatg
gggatatattcaagcagccagtttttaggtgcttttgttggtggtattctgggtggtttt
atagcgagccaatatggcgagcaaaccatcttcttagtgatgacaatagtaacggttatc
tggttgggattaagctttggtatgcagtcattgaaaaaatcaaaaagttttagttttgcc
accaatattacctgtgaagaagaagctgataaaatggccgaccaattaatcaatatgccc
ggtgttatcgaagcaaccctagtgcacaccgaggcagtcgcttatttaaaggttgatgtt
aaaacggtggatttactcgccattaaagcgttacttcaaagttag

DBGET integrated database retrieval system