KEGG   Colwellia psychrerythraea: CPS_0924Help
Entry
CPS_0924          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB
Motif
Other DBs
NCBI-ProteinID: AAZ27111
UniProt: Q487U2
Position
complement(928567..929052)
Genome map
AA seq 161 aa AA seqDB search
MPNKKQLADLVVTALSKQLQQAIDAANEAHAAAVDDQSVAETQYDTLAIEASYLAEGQSK
RVIEFQHAIDAYKALELIEFNSESYIALGALVQLSTDSDTNHWFFIGPAAGGFRCQLAQQ
NITVITPQSPMGIALIGKQLDDDIEVMLGSNKLEDYIVTLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataagaaacagctagctgaccttgttgtcactgcactctcgaaacagctgcaa
caagctattgatgctgcaaacgaagctcatgccgctgcggttgatgatcaaagtgttgct
gaaacacaatatgatacgctagcgatagaggcgagttatttggctgaaggacagtctaag
cgagtgattgagttccagcacgctatcgatgcctataaagcgcttgaactaattgaattc
aatagcgagagctatatcgctttaggcgccctggtacaattatccactgattcagacacc
aaccattggttctttatagggcctgctgccggagggtttcgctgtcagctagctcaacaa
aatatcacggtgataacaccgcaatcacctatgggaatagcattaataggtaaacagcta
gatgatgatatagaagtcatgctcggtagcaataaacttgaagattacatcgttacgtta
aaataa

DBGET integrated database retrieval system