KEGG   Colwellia psychrerythraea: CPS_0941Help
Entry
CPS_0941          CDS       T00258                                 

Definition
(RefSeq) putative lipase
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase
Motif
Other DBs
NCBI-ProteinID: AAZ28637
UniProt: Q487S5
Position
950072..951055
Genome map
AA seq 327 aa AA seqDB search
MRGIISPKLVPLLEQANIAIAAAKATGQGFSAELVRQGLDNLSALMGAGPNIAIVKDSFL
ATSSHNIPVRIYNPAPNDMLPVLLHFHGGGHMCGSADLYDPISRKLALATQAIVICVDYR
LAPEYPYPAGLDDCQQVLERYQSLLTEMKYSDELYIAGDSAGGAICTSLVMNNLINEKTS
NSIKIDKQILVYPSVDYTMASASIDENGQGFLLEKDKMHWYFQQYFQVSSLEQDEITQAK
IVKASPLLGKFSANMPTTLVITAGCDPLRDEGVAYAKSLDEVGVNVEHHSFDGMTHAYML
LNDLVSDECQQTYQLIGQFVKAGINDQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggaataatatcccccaagttagtaccacttcttgagcaagcaaatattgccatt
gctgcggccaaagcaaccgggcagggctttagtgctgaattagttagacagggcttagat
aatttatcggcgttaatgggggcagggccaaatatagcgatagtaaaagattctttttta
gcgacctctagccataatattccagttcgtatttataatcctgcgcctaatgatatgttg
ccagtattactacattttcatggcggcggacatatgtgtggcagtgccgatttatatgat
cccatcagtcgtaaactcgcgcttgctactcaggctattgtcatttgtgttgattatcga
ttagcacctgaatacccatatccagcaggcttggatgattgtcagcaagtacttgaacgc
tatcaaagccttctgacagaaatgaagtatagtgatgaactctatattgctggtgatagt
gctggtggagccatctgtactagtttagtaatgaataacttaattaatgaaaagaccagt
aattcgataaaaattgataagcaaattttggtttatccgagtgtggattacaccatggcg
agtgcttctattgatgaaaatggtcaaggtttcttattagaaaaagataaaatgcattgg
tactttcagcagtacttccaagtaagcagtttagagcaagatgaaatcacgcaagctaaa
atagtgaaagcatcaccattacttggtaagttttcagcgaatatgccaacaactttggtc
attactgctggatgcgacccgctaagagatgaaggtgtcgcttatgctaaatcgttggat
gaggtcggcgtaaatgttgaacaccattcttttgatggtatgactcacgcctatatgttg
ctaaatgatttagttagcgatgaatgccaacaaacttatcagctcattggacaatttgtt
aaagcaggtattaatgaccaataa

DBGET integrated database retrieval system