KEGG   Colwellia psychrerythraea: CPS_0943Help
Entry
CPS_0943          CDS       T00258                                 

Gene name
bdhA1
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cps  Colwellia psychrerythraea
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CPS_0943 (bdhA1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CPS_0943 (bdhA1)
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     CPS_0943 (bdhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(952016..952828)
Genome map
AA seq 270 aa AA seqDB search
MLESTPLQSTTLKGKTALITGSTSGIGLASAHVLAEQGINLVLHGLMSDDEGANLAQEFS
EKYQIKTLFDNANLMDTSAISVFMDKATKTMGSIDILINNAGIQHTEAVDTFPESKWNAI
IAINLTAAFHTTQHALSGMKANSWGRIVNIASVHGLVASKNKVAYCAAKHGIVGLTKVVA
LECAEHGITANAICPGWVDTPLINDQITEIANKESTSFEQAKYQLITAKQPVPDMMAPRQ
IGEFILFLCSDSARSITGSSLPMDGAWTAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaagtactccattacaaagcacaacattgaaaggtaaaacagcacttattact
ggttcaacaagtggtattggcttagccagtgctcacgtattggctgagcaaggtattaat
ttagtcttacatggtttgatgagcgatgatgaaggcgctaacctagcgcaggagttttct
gaaaaatatcaaataaaaaccttattcgataatgctaacttaatggacacaagtgccatc
agcgtttttatggataaagccacaaaaacgatgggctcgattgatatcttgatcaacaat
gcaggtattcaacatacagaagcagtggatacttttccagagagtaaatggaatgccatc
attgccattaatttaaccgctgcctttcatacgactcagcacgctttaagtggtatgaaa
gccaactcatggggcagaattgttaatattgcttctgttcatggccttgttgcctctaaa
aataaagtcgcatattgtgcagcaaaacatggcattgttggcctgaccaaagtcgttgct
cttgagtgcgcagaacatggcattactgccaatgctatttgtccaggctgggtagatacg
ccacttatcaatgatcaaatcactgaaattgccaataaagaaagtaccagctttgagcaa
gcaaaataccaacttattaccgccaaacagcctgtacctgatatgatggcgcctcgtcaa
attggtgagttcatcctctttctttgcagtgatagtgcccgcagcattaccggttcgtca
ttgcctatggatggcgcttggaccgctcaataa

DBGET integrated database retrieval system