KEGG   Colwellia psychrerythraea: CPS_0952Help
Entry
CPS_0952          CDS       T00258                                 

Definition
(RefSeq) GGDEF/EAL domain protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GGDEF DUF4238
Motif
Other DBs
NCBI-ProteinID: AAZ25273
UniProt: Q487R4
Position
958529..960994
Genome map
AA seq 821 aa AA seqDB search
MNIKFVGVPTKLLVLIVSTLLLLAVGFSSLSYWRLQADYQEFQQNNIVQGQVQVNLHNSI
LRTKITVWLESFTDLIQLSQQDDFSNLALQLEKQYDALQLHLNVEDIWLVDEKQNILFAT
NDFPAVVQDNIAQVFRLQEPEHRIYCPQSCQLLLSLPLLNKQGDMVVVTMSTSLVDMLFA
LKTTLDRDVAVIRIPANGEINSSSAKVISASNMRLTESLLAMNKPDSALNQVLAQGLHLD
LEKNSYLINLLTLSEQDKQGFYLALIDDVTAYKAKNDAYQKRFILSLSLIFSLLAAFVYF
ISSPFTKRLLLLSNALPLLAQKKFDQFRQVDLKRPRMFADELDVLAHSSEELSFELEQLN
LVVEQKTKELENIAMYDLLTGLPNRNMLNYQLRKSLANIARHKSGVAVLFLDLDDFKKVN
DSNGHNIGDKLLIQAAERVRVSVGELDLASRFGGDEFVIVLSHLNSVDDAIEVAEKVLLQ
FKESIKLGSNIFYVSTSIGIAYTESATEKSDDLISHADIAMYEAKDNGGGQYHIYHQEMF
QRVAHRVMLEGEVRQALAKQQFSLSLQPQICAKTKKLYGFEALLRWQHPERGMISPEDFI
PILENSQHMIELGYWIIRRCFELVISIKEYGLENIRIAINLSAGQFMDANLPHFLNDLLV
EFSLTAKNFELELTEQTLVKDMDHTIAMMESLKVIGFSFAIDDFGTGYSSLAYLKKMPVD
VIKIDKSFIFGMLENHSDFQIITSTIAMVKNLGLTVVAEGVETQAQLRSLTENDCDIIQG
YYYSKPIPEKDLFTMLDKQTTKGYWKVAKKIEPDLSTGKSA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaaatttgttggtgtaccaaccaagcttttggtactaatagtctcaacctta
ctgcttttagcggtagggttttcttcgttatcctattggcgtttacaagccgattatcaa
gaatttcagcaaaataatattgtccaaggtcaagtgcaagttaatctgcacaatagtatt
ttgcgcaccaaaattaccgtttggttagagtccttcaccgacttgattcaattatcacag
caagatgatttttctaacctagccttgcagttagagaagcaatatgacgctctacagtta
caccttaacgttgaagatatctggttagttgatgagaaacaaaatattttatttgctacc
aatgacttcccagcagtagtgcaagataacattgcacaagtctttagattacaagaacca
gaacatcgaatatattgcccacaaagctgtcaattgttattgagtttacctttactcaat
aagcaaggtgatatggtggttgttaccatgagtacttcattggttgatatgctgtttgct
ttgaaaaccactttagatagagatgttgctgtaattcggatacccgctaatggtgaaatt
aactcgtcctcagctaaagtgatttcggcatctaatatgcgactaacagagtccttatta
gcgatgaataaacctgattcagcacttaatcaagtattagcgcaggggttacacttagat
ttagaaaaaaatagctacctgataaacctattaactttatcagagcaagacaaacaaggt
ttttatctcgctttaattgatgatgtgacagcttataaagcaaagaatgatgcataccaa
aagcgctttatattatctttgagtcttatttttagtttactagcggcatttgtttacttt
atttctagtccctttactaaacgattattgctgttatctaatgcgcttccgttattagca
cagaaaaagtttgatcagtttagacaagttgacctaaaaagacctcgaatgtttgcggat
gaattagatgtattagctcattcatctgaagagctgagctttgaattagaacaactcaac
ttagtggtagagcaaaaaactaaagagttagaaaatatagcgatgtatgatttgctaacg
ggtttgcctaatcgtaatatgcttaattatcaattgcgtaagtcattagcaaatattgct
cgccataaaagtggtgttgctgtgctgtttctcgatttagatgactttaaaaaggttaat
gacagtaatggtcataatattggtgataagttacttattcaagctgctgagcgtgtgcgg
gttagtgttggtgaactagatttagcgagtcgttttggcggtgatgaatttgttattgtg
cttagccaccttaacagtgtcgatgatgctattgaagtagcggagaaggtactgttacag
tttaaagagtcgataaaacttggctctaatatattttatgtttcaacgagtattggtatt
gcttatacagaatcagcgacagaaaagtcggatgatttgatcagccatgctgatatcgcc
atgtatgaagcaaaagataatggcggtggtcagtatcacatctatcaccaagaaatgttt
caacgtgtcgctcatagggtgatgcttgaaggtgaagtcagacaagcgttagctaaacag
cagtttagtctaagtctacaaccgcagatatgtgcaaaaactaaaaagctatatggtttt
gaagcactattacgctggcaacaccctgaacgcggaatgatctcgccagaggactttatt
cctattttagaaaactctcaacatatgatcgaattaggttattggattattcgccgatgc
tttgagttagtaataagtatcaaagaatacggcctagaaaacatacgtattgcgattaat
ttatctgcgggacagtttatggatgctaatttaccgcatttcctaaatgatttattggtc
gaattctcattaacagcgaaaaattttgaactagagcttactgagcaaacgttagtgaaa
gatatggatcataccattgcgatgatggagtccttgaaagttattggctttagttttgct
attgatgattttggtacgggttattcatcgttagcgtatttaaagaaaatgcctgttgat
gttattaaaatagataagagttttatttttggcatgttagaaaatcattctgactttcaa
attattacttcgactatcgcaatggttaaaaacttaggtttgacggtagtagcagaaggg
gtagaaacacaagcgcaattacgtagcttaactgaaaatgattgcgatattattcaaggc
tattattattctaagcctattccagaaaaagacttgtttactatgctagacaagcaaaca
acaaaaggctattggaaagtagccaagaaaattgagccagatttatcaacaggtaagtct
gcttga

DBGET integrated database retrieval system