KEGG   Colwellia psychrerythraea: CPS_0976Help
Entry
CPS_0976          CDS       T00258                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_0976 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_0976 (glk)
   00052 Galactose metabolism
    CPS_0976 (glk)
   00500 Starch and sucrose metabolism
    CPS_0976 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CPS_0976 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPS_0976 (glk)
   00524 Butirosin and neomycin biosynthesis
    CPS_0976 (glk)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CPS_0976 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(981668..982687)
Genome map
AA seq 339 aa AA seqDB search
MNIEKESTLVSLIADIGGTNIRLAQATAKLGTNTRDIAINDIETYQCKEFSSLADVVAHY
IDVKELNNLAINACFAIACPVDNDLISMTNLPWQFSQNELKQSLNLHSLRFINDYTAIAM
AIPLLSEQQKIKIGGGESIAGKPISVCGPGTGLGVANLVPLSLSGNEQWHCISGEGGHID
FAPVNEIEQQVMNFIQGIKKRVSYEQLLSGYGLEQIYQALLFINHGKEITTVEDKLTAKD
ITANALNATCTVCEQTLTLFCDVLGSFAGNLALIMNSQGGVYIAGGIVPRFVDYLKLSDF
RARFETKGRLSSITEQAPTYVITEEQPGLLGAAAFVLQS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaaaaagaaagcactctggtcagcctaattgcggatattggcggtaccaat
attcgcttggctcaagcaacagcaaagctcggcacgaatacgcgtgacattgctattaat
gatattgagacctatcaatgcaaagagttttctagcttagctgatgtggttgcacattat
attgatgttaaagaactgaataacttggccattaacgcttgtttcgctatcgcttgccct
gtagataatgacttgattagcatgactaatttaccttggcagttctctcaaaacgaactc
aaacagtcattaaatttacattcattacgctttattaatgactacaccgcaatagccatg
gccattcctctgctatcagaacaacagaagattaaaataggtggcggcgaaagtattgcg
ggtaaacccatttcagtctgtggaccaggtacagggttaggtgttgcaaacttagtacca
ctgtctctgtcaggcaatgagcaatggcattgcattagtggtgaaggtggtcatattgat
tttgctccggttaatgaaatcgagcaacaggtgatgaactttatccaaggcatcaaaaag
cgagtttcatacgaacagttattgtcaggttatggcttagagcaaatctatcaagcactg
ttatttattaatcatggcaaagaaattaccacggttgaagacaaacttaccgctaaagat
attacggcgaatgcgcttaacgccacttgtactgtttgtgagcaaacactgacactcttt
tgtgatgtgctgggtagctttgccggtaaccttgccttaataatgaatagccaaggcggt
gtttatattgctggcggcatagtgccgcgttttgttgactatttaaaactgagtgacttt
agagcgcgctttgaaacaaagggacgactctcctctatcacagagcaagctcctacctac
gtgataactgaagagcaaccaggattacttggcgccgcggcttttgttttacaaagctaa

DBGET integrated database retrieval system