KEGG   Colwellia psychrerythraea: CPS_1128Help
Entry
CPS_1128          CDS       T00258                                 

Gene name
suhB
Definition
(RefSeq) inositol-1-monophosphatase
  KO
K01092  
myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cps  Colwellia psychrerythraea
Pathway
Streptomycin biosynthesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CPS_1128 (suhB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPS_1128 (suhB)
Enzymes [BR:cps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     CPS_1128 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1150276..1151079)
Genome map
AA seq 267 aa AA seqDB search
MHPMLNIAVRAARTAGKVIVRSMEQLDKVEVESKGTNDFVTSVDISSEEAIIETIRKSYP
DHTIIGEESGILKGSDDDYQWIIDPLDGTSNFIKGIPHFAVSICLKVKGKLDQAVVFDPI
RGELFSASRGKGAQLNGFRIRVNKNKEIAGTILATGFPFKHKQHSVAYMAMFSNLFQKSS
DMRRSGSTALDLAYVAAGRVDGFFEIGTKPWNTAAGELLVIEAGGLVTDFTGGHNHANSG
NIVAANTRILKDVLKEIRPHLGDALSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatcccatgctaaatattgccgtgcgcgcagcgcgtacagccggtaaagttatcgtt
cgctctatggagcaacttgataaagttgaagttgaatcaaaaggaactaacgatttcgtc
accagtgttgatattagctctgaagaagccattattgaaactattcgtaaatcttaccct
gaccacactattattggtgaagagtctggtattttaaaaggcagtgatgatgattaccaa
tggattattgatccattagatggcacaagtaacttcattaaaggcattcctcattttgct
gtttcaatttgtttaaaagttaaaggcaaattagatcaagctgttgtatttgacccaatt
cgtggcgaattattctcagccagtcgtggtaaaggtgcacaactaaacggttttagaatc
cgtgtaaacaaaaacaaagaaattgcaggcactatattagcgactggatttccattcaaa
cataagcaacacagcgtagcttatatggcaatgttttcaaatttattccaaaaatcttca
gatatgcgccgttcaggttcaactgcacttgaccttgcctatgtagcagcaggccgtgtt
gatggtttcttcgaaattggcactaaaccttggaataccgctgctggcgaactattagtg
attgaggcaggtggtttagttactgactttactggcggtcataatcatgcaaattcaggt
aacattgttgcagcaaatactcgtatattaaaagacgttttaaaagaaattcgcccacat
ttaggtgatgcgcttagcaagtaa

DBGET integrated database retrieval system