KEGG   Colwellia psychrerythraea: CPS_1196Help
Entry
CPS_1196          CDS       T00258                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cps  Colwellia psychrerythraea
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cps00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1226297..1227403)
Genome map
AA seq 368 aa AA seqDB search
MTTITSTFYNKLSNCLCPPGNGVFTVNTAKERKEQLHQTIFGQAVGVEDLWKTSLNQLPE
ASKAVILGVASDCGGGILRGANWGPLFLRSTLLATYPELTAFDLGDVRVIPHLLSDKYLN
EATLANCKKALYQDEHSKYAISPLSITEDVLHDFYAEFPEKGIFGIGGDHSVSYPLTKAY
LQAKKKQGKRAAIIHFDAHTDLLVERLGIDLCFGSWCTHILDDLHEKHHLIQVGIRSSGR
PQSHWEETFGVRQHWAKDIKAHGIDQTIENIFAQLEDENIDELYVSFDIDAIDDSFACAT
GTPEPDGLMPEDAMGILRALAAKYPITGADMMEIAPFTDSCGQGLAGQEKTLKVGAEISA
FLISQMSK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaattacatcaacattttataacaaactaagcaattgtttgtgtcctcccggc
aatggcgtatttaccgtaaataccgctaaagagcgtaaagagcaattacaccaaactata
ttcggacaagcggttggagttgaggatttgtggaaaacgtcattaaatcaactgccagaa
gcgtctaaagcagttattttaggtgtagcatcagattgtggtggtggtattttacgtggt
gctaactggggtcctttatttttacgttcaactttacttgcaacttaccccgaattaact
gcatttgatttaggtgatgtccgtgttattccacatttattatcagataaatatttaaac
gaagcgacgttagctaactgtaaaaaagctttatatcaagatgagcatagtaaatatgcc
attagcccattaagcattacagaagatgtgttacatgacttttatgctgaattcccggaa
aaaggcattttcggcattggcggtgatcacagtgttagttaccctttaaccaaagcctat
ctgcaagctaaaaagaaacaaggtaaacgtgctgcaataattcactttgatgctcatact
gatttattggttgagcgcttaggaatagatttatgttttggctcttggtgtacccatatt
ttagatgacctgcatgaaaaacatcaccttattcaagttggaattcgctcaagtggcaga
cctcaaagtcattgggaagagacttttggtgtgagacagcattgggcaaaagatattaaa
gcacatggtattgaccaaacaatagaaaacatttttgctcaactcgaagatgaaaatatt
gacgagctttatgtaagttttgatattgatgccattgatgacagttttgcctgtgcaaca
ggtacgcctgagccggatggtttaatgccagaagatgccatgggcatattacgcgcctta
gctgctaagtatccaattacgggtgctgatatgatggagatagcccctttcacagatagt
tgtgggcaagggttagcaggacaagaaaaaaccttaaaagtaggcgctgaaatttcagca
tttttgataagtcagatgagtaaataa

DBGET integrated database retrieval system