KEGG   Colwellia psychrerythraea: CPS_1228Help
Entry
CPS_1228          CDS       T00258                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cps  Colwellia psychrerythraea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_1228 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPS_1228 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_1228 (glcB)
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CPS_1228 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258969..1261137)
Genome map
AA seq 722 aa AA seqDB search
MVATVTIENLTVSQCLFDFIENEALPDTSISSSHFWQQFSSIIHDLSPENKQLLLKRDAL
QASINSYHQDNKPLDFSHYKKFLADINYLVPQVDDFSINTSNVDNELALMAGPQLVVPIM
NARFALNAVNARWGSLYDALYGTDVISHENGAQPGKTYNPVRGKKVIAFAKGYLDQAIPL
LTGNHSQAISYHLTEHQLMVSLADGQQSPLKDPSAFIGFTGSINKPDSLMFTHNGLHLNL
LFSDDSAIGKEDAAGLSDVVLESALTTIMDCEDSVAAVDGEDKVIAYRNWLGLMTGKLSA
KLNKNGKTITRTMNNDLSVQTLTGDTVTLKGRSLMFVRNVGHLMTNNAIIDSQGNEVPEG
ILDAMITSLIALHDLKGNSAFSNSSEGSIYIVKPKMHGPEEVAFANTLFSRVETALSLPQ
NTVKMGIMDEERRTSVNLKNCIFAAKDRVVFINTGFLDRTGDEIHTSMMAGPMARKADIK
LTPWIGAYEDNNVDVGLACGFSQKAQIGKGMWPIPDQMANMIATKINHVEAGANTAWVPS
PTAATLHSLHYHRVNVFELQKQLAKRQPANIDDILTIPLAEHTNWTEQEISDELDNNCQG
ILGYVVRWIDDGVGCSKVPDINNVGLMEDRATLRISSQHIANWLTHNICTIEQVQASLEK
MANIVDKQNASDSSYQAMSNDFTNSIAFKAAAALIFSGVEQPNGYTEPLLHQYRLEKKRQ
LS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggtagcgacagtaacgatagagaacttaacagtaagccaatgtctttttgattttatt
gaaaatgaagccctacctgacacttctattagctcaagtcatttttggcagcaattttcc
agtataattcatgatctgagcccagaaaacaaacagcttttattaaaacgtgatgcctta
caagcaagcataaatagctaccatcaagacaataagccacttgatttttctcactataaa
aaattcttagcggatattaactaccttgtacctcaagtagatgattttagtatcaacacc
agtaatgttgataacgaattagcgttgatggcagggccacaacttgttgtgccaataatg
aatgctcgttttgcgctaaatgccgtaaatgctcgttggggaagtttatatgacgcactc
tatggcactgatgtaatcagccatgaaaatggtgcacaaccaggaaaaacatataacccg
gtgcgtggtaaaaaggttatcgcgtttgccaaaggttatttagatcaagccattccactg
ctcactggtaatcatagccaagcaattagctaccacttaaccgaacaccaattaatggta
agtttggctgacggtcagcaaagtcctctgaaagacccttctgcatttataggctttact
ggcagtataaataagccagattctctgatgtttactcataacggtttacatttaaaccta
ctgtttagcgatgacagtgcaataggcaaggaagatgctgccggattaagcgatgtagta
cttgaatcagcgttaacgaccattatggattgtgaagattcggttgcggctgttgatggt
gaagataaagtaatcgcttaccgaaattggttaggactaatgacgggcaagttaagcgcc
aaactgaataaaaatggtaaaaccataacccgcaccatgaacaatgatttgagtgttcaa
acactaactggcgacacagttaccctcaaaggtcgtagcttgatgttcgtacgtaatgtt
ggccatttgatgacaaacaatgccattatcgatagtcaaggtaatgaagtacctgaaggt
atactcgatgctatgatcacttctttgattgccctgcatgatttaaaaggtaatagcgca
tttagcaatagtagtgaaggttctatttacattgttaagcccaaaatgcacggacctgag
gaagttgcttttgctaatacattattctcacgtgtagaaactgcattatcattacctcaa
aacaccgtcaaaatgggtataatggatgaagagagacgtaccagtgttaatttgaaaaac
tgtatttttgctgctaaagaccgtgtggtttttatcaatactggctttttagatagaacg
ggtgacgagattcatacctctatgatggccggacctatggcaagaaaagcagatataaaa
ctaactccttggattggtgcttatgaagataacaatgtagatgttggcctcgcttgtggt
tttagtcaaaaagcacaaataggtaaaggcatgtggcctattccagatcaaatggcaaat
atgatcgcaactaaaatcaatcatgttgaagctggagcaaacactgcttgggttccttca
cctaccgctgctacattgcactcgctgcactaccatagagtgaatgtgtttgagttacaa
aagcaacttgctaaacgtcagccggctaatatagacgatattttaacaattccattagca
gaacatactaattggactgagcaggaaattagtgatgagttagacaataactgtcaaggc
attttaggctatgtagttcgctggatagatgatggcgtaggctgctctaaagttccggat
ataaacaatgtcggcttgatggaagatagagccactttacgtatttctagccaacacatc
gctaactggcttactcataacatttgtactattgaacaagttcaagccagtttagagaaa
atggcaaatattgttgataaacaaaacgctagtgatagtagttatcaagcgatgagtaat
gacttcaccaatagcattgcttttaaagctgctgctgcattgatattttcaggcgtagaa
cagcctaatggttataccgaacctttactgcaccaatatcgcttagaaaaaaagcgccaa
cttagctaa

DBGET integrated database retrieval system