KEGG   Colwellia psychrerythraea: CPS_1228Help
Entry
CPS_1228          CDS       T00258                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cps  Colwellia psychrerythraea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_1228 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPS_1228 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_1228 (glcB)
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CPS_1228 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258969..1261137)
Genome map
AA seq 722 aa AA seqDB search
MVATVTIENLTVSQCLFDFIENEALPDTSISSSHFWQQFSSIIHDLSPENKQLLLKRDAL
QASINSYHQDNKPLDFSHYKKFLADINYLVPQVDDFSINTSNVDNELALMAGPQLVVPIM
NARFALNAVNARWGSLYDALYGTDVISHENGAQPGKTYNPVRGKKVIAFAKGYLDQAIPL
LTGNHSQAISYHLTEHQLMVSLADGQQSPLKDPSAFIGFTGSINKPDSLMFTHNGLHLNL
LFSDDSAIGKEDAAGLSDVVLESALTTIMDCEDSVAAVDGEDKVIAYRNWLGLMTGKLSA
KLNKNGKTITRTMNNDLSVQTLTGDTVTLKGRSLMFVRNVGHLMTNNAIIDSQGNEVPEG
ILDAMITSLIALHDLKGNSAFSNSSEGSIYIVKPKMHGPEEVAFANTLFSRVETALSLPQ
NTVKMGIMDEERRTSVNLKNCIFAAKDRVVFINTGFLDRTGDEIHTSMMAGPMARKADIK
LTPWIGAYEDNNVDVGLACGFSQKAQIGKGMWPIPDQMANMIATKINHVEAGANTAWVPS
PTAATLHSLHYHRVNVFELQKQLAKRQPANIDDILTIPLAEHTNWTEQEISDELDNNCQG
ILGYVVRWIDDGVGCSKVPDINNVGLMEDRATLRISSQHIANWLTHNICTIEQVQASLEK
MANIVDKQNASDSSYQAMSNDFTNSIAFKAAAALIFSGVEQPNGYTEPLLHQYRLEKKRQ
LS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggtagcgacagtaacgatagagaacttaacagtaagccaatgtctttttgattttatt
gaaaatgaagccctacctgacacttctattagctcaagtcatttttggcagcaattttcc
agtataattcatgatctgagcccagaaaacaaacagcttttattaaaacgtgatgcctta
caagcaagcataaatagctaccatcaagacaataagccacttgatttttctcactataaa
aaattcttagcggatattaactaccttgtacctcaagtagatgattttagtatcaacacc
agtaatgttgataacgaattagcgttgatggcagggccacaacttgttgtgccaataatg
aatgctcgttttgcgctaaatgccgtaaatgctcgttggggaagtttatatgacgcactc
tatggcactgatgtaatcagccatgaaaatggtgcacaaccaggaaaaacatataacccg
gtgcgtggtaaaaaggttatcgcgtttgccaaaggttatttagatcaagccattccactg
ctcactggtaatcatagccaagcaattagctaccacttaaccgaacaccaattaatggta
agtttggctgacggtcagcaaagtcctctgaaagacccttctgcatttataggctttact
ggcagtataaataagccagattctctgatgtttactcataacggtttacatttaaaccta
ctgtttagcgatgacagtgcaataggcaaggaagatgctgccggattaagcgatgtagta
cttgaatcagcgttaacgaccattatggattgtgaagattcggttgcggctgttgatggt
gaagataaagtaatcgcttaccgaaattggttaggactaatgacgggcaagttaagcgcc
aaactgaataaaaatggtaaaaccataacccgcaccatgaacaatgatttgagtgttcaa
acactaactggcgacacagttaccctcaaaggtcgtagcttgatgttcgtacgtaatgtt
ggccatttgatgacaaacaatgccattatcgatagtcaaggtaatgaagtacctgaaggt
atactcgatgctatgatcacttctttgattgccctgcatgatttaaaaggtaatagcgca
tttagcaatagtagtgaaggttctatttacattgttaagcccaaaatgcacggacctgag
gaagttgcttttgctaatacattattctcacgtgtagaaactgcattatcattacctcaa
aacaccgtcaaaatgggtataatggatgaagagagacgtaccagtgttaatttgaaaaac
tgtatttttgctgctaaagaccgtgtggtttttatcaatactggctttttagatagaacg
ggtgacgagattcatacctctatgatggccggacctatggcaagaaaagcagatataaaa
ctaactccttggattggtgcttatgaagataacaatgtagatgttggcctcgcttgtggt
tttagtcaaaaagcacaaataggtaaaggcatgtggcctattccagatcaaatggcaaat
atgatcgcaactaaaatcaatcatgttgaagctggagcaaacactgcttgggttccttca
cctaccgctgctacattgcactcgctgcactaccatagagtgaatgtgtttgagttacaa
aagcaacttgctaaacgtcagccggctaatatagacgatattttaacaattccattagca
gaacatactaattggactgagcaggaaattagtgatgagttagacaataactgtcaaggc
attttaggctatgtagttcgctggatagatgatggcgtaggctgctctaaagttccggat
ataaacaatgtcggcttgatggaagatagagccactttacgtatttctagccaacacatc
gctaactggcttactcataacatttgtactattgaacaagttcaagccagtttagagaaa
atggcaaatattgttgataaacaaaacgctagtgatagtagttatcaagcgatgagtaat
gacttcaccaatagcattgcttttaaagctgctgctgcattgatattttcaggcgtagaa
cagcctaatggttataccgaacctttactgcaccaatatcgcttagaaaaaaagcgccaa
cttagctaa

DBGET integrated database retrieval system