KEGG   Colwellia psychrerythraea: CPS_1232Help
Entry
CPS_1232          CDS       T00258                                 

Gene name
icl
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00630  Glyoxylate and dicarboxylate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01200  Carbon metabolism
Module
cps_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_1232 (icl)
Enzymes [BR:cps01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CPS_1232 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AAZ25755
UniProt: Q486P0
Position
1264150..1265733
Genome map
AA seq 527 aa AA seqDB search
MSNYQSAIEAVQAIKANAGSSWDAINPESVARMRAQNKFKTGLEIAQYTADIMRADMEAY
DADSSKYTQSLGCWHGFVGQQKMISIKKHFDGKTDRRYLYLSGWMVAALRSEFGPLPDQS
MHEKTSVASLVEELYTFLRQADARELGGLFRELDAANAGDKAAIQDQIDNHVTHVVPIIA
DIDAGFGNAEATYLMAKQMIEAGACALQIENQVADEKQCGHQDGKVTVPHADFHSKIRAL
RHAFLELGIDNGIIVSRTDSEGAGLTKEIAVVKEPGDQGDIYNSFLDVEEIDVADMAEGD
VCFNRDGKLVRPKRLPSGLYQFRQGTGEERCVFDSIEAIKAGADLLWIETATPSVKDIAG
MMNEVRKVIPNAKLVYNNSPSFNWTLNFRQQAFDAMVEAGEDVSSYVRADLMNEDYDSSG
LAAKADDKIRTFQADTSREAGIFHHLITLPTYHTTALSVDNLAKEYFGDAGMLGYVEGVQ
RKEIRQGIACVKHQNMSGSDMGDDHKEYFAGENALKAGGANNTSNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatcaaagtgcaatagaagcggttcaagcgattaaagcaaatgcaggtagc
tcttgggatgctataaacccagaatctgtagctcgaatgcgtgcacagaacaaattcaaa
actggtttagagattgctcagtatactgcagacattatgcgtgctgacatggaagcttat
gatgctgatagctctaaatacactcaatctctaggttgctggcatggttttgttggccaa
cagaaaatgatttctatcaagaagcattttgatggcaaaacagaccgtcgttatttatac
ctttctggttggatggttgcagcactacgtagcgaatttggtcctcttcctgatcaatct
atgcatgagaaaacttctgtagcttctttggttgaagaactttataccttcctacgtcaa
gctgatgcacgtgaactaggtggtcttttccgtgaactagacgcagcaaatgctggcgat
aaagctgctatccaagatcaaattgataaccatgttactcatgttgtgccaattattgct
gatattgatgctggttttggtaatgctgaagcgacttacttaatggctaagcaaatgatt
gaagcgggtgcttgtgctcttcaaattgaaaaccaagttgctgatgaaaagcaatgtgga
catcaagacggtaaagtaacggttcctcacgctgatttccattctaagattcgtgcatta
cgtcatgctttcctagaactaggtatcgacaacggtattatcgtttcacgtactgattct
gaaggtgctggtcttactaaagaaatcgctgttgttaaagaaccgggcgatcaaggcgat
atatataactctttcctagacgttgaagaaattgacgtagctgatatggctgaaggcgat
gtatgtttcaatcgtgacggtaaattagtacgtcctaagcgtttaccttctggtttatac
caattccgtcaaggtactggtgaagagcgttgtgtatttgatagcatcgaagcaattaaa
gccggcgctgaccttctttggattgaaactgcaacaccgagcgtgaaagatatcgcgggt
atgatgaatgaagtacgtaaagtgattccaaatgctaagcttgtttacaacaacagccca
tcatttaactggacgttaaacttccgtcaacaagcattcgacgcaatggttgaagctggt
gaagatgtatctagctatgttcgtgctgacttaatgaatgaagattacgattcaagtgga
ctagctgctaaagctgatgacaagatccgtactttccaagctgatacgtcacgtgaagcc
ggtattttccatcacctaatcacacttcctacttatcacacaacggcattgtctgttgat
aacttggctaaagagtacttcggtgatgcgggtatgcttggttatgttgaaggtgtacaa
cgtaaagaaattcgtcaaggtatcgcctgtgttaaacatcaaaacatgtcaggctctgac
atgggtgatgatcacaaagaatactttgctggtgagaacgcacttaaagcaggcggcgct
aacaatacgtctaaccagttttaa

DBGET integrated database retrieval system