KEGG   Colwellia psychrerythraea: CPS_1343Help
Entry
CPS_1343          CDS       T00258                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cps  Colwellia psychrerythraea
Brite
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CPS_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1380071..1381045)
Genome map
AA seq 324 aa AA seqDB search
MIKPFLSTMLTLLCFIGLNQGYTQSSTQDIALSFFEPLPHVMQGAEQDTSALINLGKKLY
FETALSINHSQSCNSCHNLNNDAAGVDHLKVSIGALGSIGERNAPTTWNAGLHVAQFWDG
RAKTLAQQAKFPIFNVKEMALTSESQVIERLNSKGYLADFNSGFPQQLSPINLENIAQAL
AAFQRTLISKDRFDDYLAGDKDAISQSEKAGLRVFIDKGCVACHNGAVIGGQLFMKMGIV
HPYPNKIDKGKAQVTGNPADNYFFKVPSLRNILNTAPYFHDGAAATIEQAIEDTGWHQLG
IKLNEQEVKSIKIFFKTLNNQKRI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaccttttctttcaacgatgctgacattgttatgttttattggccttaatcaa
ggttacacgcagtcctcaacacaggacattgcgctatctttctttgaaccgcttccccat
gttatgcaaggagctgaacaagatacctcagcattaattaacttaggtaaaaaattatac
tttgaaaccgcgctatcaataaaccattctcaatcatgtaatagctgccataatctcaac
aatgatgcagcaggtgtcgatcacttgaaggtatctataggtgccttgggaagtatcggt
gaacgtaatgctcccactacatggaatgctggtttacatgtcgctcaattttgggatggg
cgagcgaaaacgttagcgcaacaagctaagtttcctattttcaatgtaaaagaaatggcg
ttgacctctgaaagtcaggtaatagaacgccttaacagtaaaggttatttagctgatttt
aacagtggctttccacaacaattatcgccaataaacctagaaaacattgcccaagcactt
gccgcatttcagcgaacattaatctcaaaagatcggtttgatgattacttagcaggcgat
aaagatgcgatcagtcaaagtgaaaaagcaggcttacgggtatttatagataaaggttgt
gttgcttgtcacaatggcgcagtcattggtggtcaactctttatgaaaatgggtatagtg
catccatatccaaataagatagataaaggtaaagcgcaggtaacggggaatcccgctgac
aattatttttttaaagtaccttctttgcgaaacatactcaacaccgccccctattttcat
gacggtgccgcggcaactatagagcaagcaattgaagataccggttggcatcaactaggt
attaaactcaacgaacaagaagttaaatcgattaaaatcttttttaagacccttaataat
caaaaaagaatttaa

DBGET integrated database retrieval system