KEGG   Colwellia psychrerythraea: CPS_1431Help
Entry
CPS_1431          CDS       T00258                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:cps01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cps00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cps00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cps00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:cps00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:cps00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1468346..1469506
Genome map
AA seq 386 aa AA seqDB search
MSTQVILPRIMQVGENASQEIANVLVSIGCTRPLIITDKMMVGLGYARRIQVSLGAHHIP
AHIFDDTVPEPTVESIQAGVDKAREGNYDCIIALGGGSPIDSAKAIAILAKHGGVMQDYR
FPRMVIEQGLPVIAVPTTAGTGSEVTKFTIITDEKNDEKMLCVGIGFMPVAALVDYKLTI
SLPPRTTADTGIDALTHAIEAYVSKKANPYSDSQAIAAIKLIGPNLRKVYHSGEDQDARE
AMMLGSTLAGIAFSNASVALVHGMSRPIGAFFHVPHGLSNAMLLPSVTAFSIPAAPARYA
DCARAMGIAAEQDSNEVANQKLLIELRSLNEELAVPTPQEFGIKRDEFFEVCQTMAEQAL
ASGSPSNNPIEPSINEIISIYQGLWD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcaagttattctgccacgtattatgcaggtgggtgaaaacgcaagtcaggaa
atagccaacgtattagttagtattggctgtacccgaccattgattattactgacaagatg
atggtgggattgggctacgctcgtcgaattcaagtcagtttaggcgcacatcatattccc
gcccatatcttcgacgataccgtgccagagcctacagttgaatctattcaagcgggtgtt
gataaggcacgagagggtaattacgattgtattatcgcccttggtggtggaagtccaatc
gatagtgctaaagccattgctatcttggccaaacatggtggtgtgatgcaagattaccgt
tttcctcgtatggttatagagcaaggcttacctgtcattgccgtacctactacggcgggg
actggatctgaagtcactaaatttaccatcattaccgatgaaaaaaacgacgaaaagatg
ctgtgtgtcggcattggcttcatgcccgttgcagcattggtggattataaattaaccatt
agtttgcctcctaggaccactgccgatactggaatcgatgccttgacccatgcaattgaa
gcgtatgtgagtaaaaaagcaaacccatatagtgatagtcaggcaattgctgcgattaaa
ttgattggacctaatttgagaaaggtctatcacagcggcgaagatcaagatgctcgtgaa
gctatgatgctgggttcgaccttagctggtattgcattctctaacgcatcggtggcatta
gtgcatggtatgagtcgacctattggtgccttttttcatgtacctcatggtctctcaaat
gcgatgttattgcccagtgttaccgctttttctattcctgcggcaccagcgcgttatgcg
gattgtgctcgggcgatgggtattgcagctgagcaagatagcaatgaagttgccaatcag
aaattattaatcgagcttcgttcactaaatgaagaattagcagtaccaacgccacaggaa
tttggtattaagcgcgatgagttttttgaggtgtgtcaaacaatggctgaacaagcatta
gcttcaggctcaccgagtaataaccctattgagccatctatcaacgaaattatcagtatt
taccaggggctatgggattaa

DBGET integrated database retrieval system