KEGG   Colwellia psychrerythraea: CPS_1523Help
Entry
CPS_1523          CDS       T00258                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cps  Colwellia psychrerythraea
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cps00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CPS_1523 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CPS_1523 (cheB)
Enzymes [BR:cps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CPS_1523 (cheB)
Two-component system [BR:cps02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CPS_1523 (cheB)
Bacterial motility proteins [BR:cps02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CPS_1523 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1566644..1567783
Genome map
AA seq 379 aa AA seqDB search
MAYKVLVVDDSSFFRRRVTDILNKDPKLNVIDVAVNGQEAVDKALLLKPDVITMDIEMPI
LNGIEAVRKIMAQSPTSILMFSSLTHQGAKATLEALDAGALDFLPKKFSEIAKNSDEAGS
LLRQRVVEIARKSEFSKQRTRTRPAAVNISPKSSRLIADQHRPLASTSSLVTKDKKVMAA
ITRSSGKEYKLLAIGTSTGGPVALQKILVQLEENFPLPIIIVQHMPAAFTAAFASRLNSL
CKISIKEAADGDVLKPGCAYLAPGGRQMLISGSENSAKIKILDDDSPKITFKPSVDISFG
SAAKTFAGKVLGVILTGMGSDGKEGARMLKAKGATIWSQDEQSCVVYGMPQAIDKAGISE
LSLSLDSMAASMVKEISRG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcctacaaggtacttgttgttgatgattctagtttttttagacgcagagttactgac
atccttaataaagatccaaaattaaacgttattgatgtggccgttaacggtcaagaagca
gtagataaagctttattgcttaaaccagatgttattacgatggatatcgaaatgccaatt
cttaatggcattgaagccgtaagaaaaattatggctcaatctccaacatcaatattaatg
ttttcatccctaacccaccaaggagcgaaagcaaccttagaagcacttgatgccggggca
ttggattttttaccgaaaaaatttagtgagatagctaaaaatagtgatgaagctggtagc
ctattacgccaacgagtcgtagaaatagcgagaaaatctgaattttcaaaacaacgcaca
cgtactcggccagcggcagtaaatattagtccaaagtcttcaagattaattgcagatcaa
cataggccattagcatcaacttcttctttagtaactaaagataaaaaagttatggctgct
attactcgaagctcgggtaaagaatataaattattggcaattggtacatcaacaggtggt
ccagtagccctacaaaagatattagttcaacttgaagagaattttcctttaccaatcata
atcgttcagcatatgccagcagcatttacagcagcatttgctagtcgcttgaattctttg
tgtaaaatatcgattaaagaagccgctgatggggatgttttaaaacccggttgtgcttac
ttagccccaggtgggcgacaaatgcttatttccggtagtgaaaattcagcaaagattaaa
attttagatgatgactctcccaaaataacctttaaacctagtgttgatattagttttggc
tcagccgcaaaaacatttgctggcaaagttttaggagtgattttaactggaatgggctct
gatggtaaagaaggagccagaatgttaaaagctaaaggggcaactatttggtctcaggac
gagcagtcctgtgtagtttatggtatgcctcaggctatcgacaaagcaggaatatctgaa
ttatctctctctttggactctatggctgcatcgatggtaaaggaaatcagtcgtggataa

DBGET integrated database retrieval system