KEGG   Colwellia psychrerythraea: CPS_1954Help
Entry
CPS_1954          CDS       T00258                                 

Gene name
trpB1
Definition
(RefSeq) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPS_1954 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS_1954 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPS_1954 (trpB1)
Enzymes [BR:cps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CPS_1954 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2016967..2018169
Genome map
AA seq 400 aa AA seqDB search
MKENYFKKYPNKDGFFNEYGGAFIPPNLEEEMKKINDAYFAISKSHKFISELRDIRKYYQ
GRPTPVYHCQRLSEKYGGQIYLKREDLNHTGAHKLNHCMGEALLAKHLGKKKLIAETGAG
QHGVALATAAAYFGLECEIHMGEVDIKKEYPNVLRMKVLGATVIPVTHGLKTLKEAVDSA
FEAYLKDPISTIYCIGSVVGPHPFPMIVRDFQRVIGIEAREQFLDMTGELPDSVVACIGG
GSNAMGIFSSFLEDDETQLFGIEPAGKSFKTGEHAATMTLGKPGLIHGFKCYILQDENGE
PAPVHSIASGLDYPGVGPEHSMLKDMNKVTYDSITDKECIDAFYELSRLEGIIPALESAH
AVAYAMKLAQKFPEKSVLVNLSGRGDKDLDYVVDTFGLPE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaattattttaaaaagtacccaaacaaagacggattttttaatgaatatggc
ggtgcatttattcccccaaatttagaagaagaaatgaaaaaaattaatgatgcttacttt
gctattagtaagtcccataaatttatttcagagcttcgtgatattagaaaatattatcaa
ggtcgtccgactcctgtttatcattgccaacgcttatcagaaaaatatggtggccaaatt
tatttaaaaagagaagatttaaaccatactggtgctcataagttaaatcattgtatgggt
gaagcattgctcgctaaacacttaggtaaaaagaaactaattgctgaaacgggcgcagga
caacatggtgttgccttggctaccgcagcggcttattttggcttagagtgcgaaatacat
atgggcgaagttgatataaaaaaagagtaccctaatgtactgcgcatgaaagtattaggg
gcaactgttatccccgtaacgcatggtttgaaaactttaaaagaagcggtagatagtgct
tttgaagcgtaccttaaagatcctatttcaaccatttattgcatcggttcagttgtgggt
ccacatccatttccaatgatagtacgtgattttcaacgtgttattggcattgaagcgcgg
gaacaatttttagatatgacaggtgagttacctgacagcgttgttgcttgtattggtggt
ggtagtaatgcaatgggaatattttcttcttttttagaagatgatgagactcaattgttt
ggtattgaacctgcagggaaatcttttaaaacgggagaacatgccgccactatgactctc
ggtaagcctggtctcatccatgggtttaaatgttatatcttacaggatgaaaatggtgag
ccagcaccagtgcattcaattgccagtggacttgattacccaggcgttggtccagagcac
agtatgttgaaggatatgaataaagtgacctacgacagtattaccgataaagagtgtatt
gatgcattttatgaattgagtcgattagaaggaattattcccgctttagaaagtgcccat
gcggttgcttacgccatgaagcttgcacagaaattccctgaaaaatctgtactcgttaat
ctaagtggtcgaggagataaagatctcgattacgttgttgatacctttggtttacctgaa
taa

DBGET integrated database retrieval system