KEGG   Colwellia psychrerythraea: CPS_1970Help
Entry
CPS_1970          CDS       T00258                                 

Gene name
deoA
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00240  Pyrimidine metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CPS_1970 (deoA)
Enzymes [BR:cps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     CPS_1970 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF3677 CO_deh_flav_C
Motif
Other DBs
NCBI-ProteinID: AAZ26339
UniProt: Q483R6
Position
2038824..2040140
Genome map
AA seq 438 aa AA seqDB search
MSVTAKIIPQEIIRLKRDGKILDEQAINGFVSGLVDGNFSDSQVGAMAMAIFQQGMSIDE
RVNFTKAMMRSGEVLSWEGFDGPIVDKHSTGGVGDKVSFMLAAIVAACGGYVPMISGRGL
GHTGGTADKLESIAGFNVQPSISEFKRIVKDVGVAIISQTDNLAPADKRLYSIRDVTATV
ESIPLITASILSKKLAAGLDVLVMDVKVGNGAMMNNLDDAKALAQSITSVANGAGVKTQA
IITDMNQVLGTSAGNAIEMYETVKYLTGKQREPRLHKIVQALASAMLINTNLASSEKDAR
EKIDKVLNSGLAAEKFDRMVSALGGPKNFIEKPWDSMKKANVITEVRALQHGYIAQTDTR
AIGMSVVGLGGGRTAPTQQVDHSVGFDRILPLGVQVNRGEVIARLHAKDEDSANRAIEQF
NNAITYSEESPELPPVIY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaccgctaaaatcatccctcaagagattattcgactgaaacgtgatggtaaa
atattagatgaacaagcgataaatggctttgtttcaggccttgttgatggcaacttttca
gatagccaagttggcgctatggccatggctatttttcaacagggtatgtcgattgatgaa
agagtcaattttaccaaggctatgatgcgctcaggagaggttcttagctgggaaggtttt
gatggtcctattgttgataagcattcaacgggtggtgtcggtgataaagttagctttatg
ttagctgctatcgttgctgcttgcggcggttatgttcctatgatttcagggcgtggtttg
ggccatactggtggtaccgcagataaacttgaaagtattgctggttttaatgtacaaccc
agtattagtgaatttaaacgtattgttaaagacgttggtgttgccattatttcacaaacc
gataatttagcacccgccgataaacgtttgtattctattcgtgatgtgaccgctacagtt
gaatctattccattgatcaccgcttctatcttatcgaagaagcttgccgcaggacttgat
gtcttagtgatggatgtcaaggttggcaatggtgccatgatgaataatttagatgatgct
aaagcacttgcacaaagcattaccagtgttgctaacggagcgggcgttaaaacacaggct
attattaccgatatgaatcaagtcttgggtactagtgccggtaacgccatagaaatgtat
gaaacagttaaatacttaaccggtaaacaacgagagccgcgcttacataaaattgtgcaa
gcacttgctagtgcaatgcttattaatacaaatctagcgagtagtgaaaaagatgcccgt
gagaaaattgataaggtattaaattcaggcttagcggctgaaaaatttgatcgcatggta
tccgcgttaggtggaccgaaaaactttatagaaaagccttgggactcaatgaaaaaggca
aatgttattactgaggtgcgagcattacagcatggttacattgcgcagacggacactcgt
gctattggcatgtcggtggttggtttaggtggagggagaacggcacctacacaacaggta
gatcacagtgttggttttgatcggatattaccactgggtgtacaagtgaatcgtggcgaa
gtgattgcacgtttacatgctaaagatgaagactcagccaatagagccattgagcaattt
aataatgcgattacttactctgaagagagccctgagctaccaccggtaatctactaa

DBGET integrated database retrieval system