KEGG   Colwellia psychrerythraea: CPS_2107Help
Entry
CPS_2107          CDS       T00258                                 

Gene name
galU2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cps  Colwellia psychrerythraea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPS_2107 (galU2)
   00052 Galactose metabolism
    CPS_2107 (galU2)
   00500 Starch and sucrose metabolism
    CPS_2107 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    CPS_2107 (galU2)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CPS_2107 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2191500..2192399
Genome map
AA seq 299 aa AA seqDB search
MNNKITKAVIPVAGLGTRMLPATKAIPKEMLPIVDKPMIQYIVDECVAAGIKEIVLVTHS
SKNAIENHFDKSFELETTLEKRVKRQILDEIQAICPKGVTIMHVRQGEAKGLGHAVLKAR
PIIGESPFVVVLPDVILDDASSDLKTENLAAMLTRYYEVGHSQIMVEPVPINMVSNYGVA
DCKGHELVAGESKAMTAVVEKPPVDEAPSNLAVVGRYVLSEKIWDMLEFTPPGAGDEIQL
TDAIASLMKIETVEAFHMTGKSHDCGSKLGYMKANVEYGLRHPELADDFKAYLQEIVNS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaaataacaaaagcagttatccccgtagcaggtttaggtacacgtatgtta
ccagccacaaaagctatccctaaagaaatgttaccgatcgtcgataaacctatgatccaa
tacatagtagatgaatgtgtggccgcaggtattaaagagatagtcttagtaacgcattct
tcaaaaaatgccattgagaatcactttgataagtcatttgagcttgaaacaacgcttgaa
aaacgtgtcaaacgccaaatattagatgaaatacaagctatttgccctaaaggcgttact
atcatgcatgtacgccaaggtgaagctaagggcttaggtcatgctgttttaaaagcacgt
ccgattattggtgagtcaccatttgttgtagttttacctgacgtgattttagatgatgct
agtagcgatttaaaaactgaaaatttagcagcgatgcttactcgttattatgaggttggg
cacagtcaaattatggttgagcctgttcctataaatatggttagtaattatggtgtggcc
gattgtaaaggtcatgaacttgtagcgggtgagtctaaagctatgactgcagttgttgag
aaacctccagttgatgaagcaccttccaatttagctgtggttggccgttatgtgctatca
gagaaaatttgggatatgcttgaatttacgcctcctggtgcaggagacgaaatccagctt
acagatgcaattgctagtttaatgaaaattgaaacagttgaggcttttcatatgacaggt
aagtcacatgattgcggttctaagttgggttatatgaaagctaatgttgagtacggttta
cgtcatcccgagttggctgatgattttaaagcgtatttgcaggaaattgttaatagttaa

DBGET integrated database retrieval system