KEGG   Colwellia psychrerythraea: CPS_2116Help
Entry
CPS_2116          CDS       T00258                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cps  Colwellia psychrerythraea
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cps03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2204993..2205628
Genome map
AA seq 211 aa AA seqDB search
MIGRLRGMLVEKNSPEILIECAGVGYEVTMPMTSIYALPELEQQATIYTHFVVREDAQLL
YGFANKVERKLFRLLIKVNGVGPKLALAILSNMSADQFVSCVRHDDISAIVKIPGVGKKT
AERLLIEMRDRLKDWQAQQIHLVSDDGVIPEQLSAELSQETTFVNDNKGDAINALLSLGY
KQVQADKAVKSVYNRGMSSENIIRDALKSMI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgtttacgtggcatgcttgtggaaaaaaactctcctgaaatattaattgaa
tgtgctggcgtgggctatgaagtcaccatgccaatgacgagtatttatgccttacctgag
cttgaacagcaggcaactatttatactcactttgttgtacgtgaagatgctcaattgctt
tatggcttcgccaataaagtagaacgtaagttattccggttattaattaaagttaatggt
gtaggtcctaaattagcgttagctattttatcaaacatgtctgctgatcaatttgttagt
tgtgttcgtcacgatgatattagcgccattgtaaaaatcccgggtgttggtaaaaagaca
gcagagcgtttgcttattgaaatgcgtgatcgtttgaaagattggcaagcacaacaaata
cacttagttagtgatgatggcgtgataccagaacaactctctgctgaattgagccaagaa
actacttttgttaatgataataaaggcgatgctattaacgctttactttcacttggctat
aaacaagtacaggcagataaagcggttaaatccgtatataatcgcggtatgtctagcgaa
aacattattcgcgatgcattaaaatcaatgatatag

DBGET integrated database retrieval system