KEGG   Colwellia psychrerythraea: CPS_2220Help
Entry
CPS_2220          CDS       T00258                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cps  Colwellia psychrerythraea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_2220 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPS_2220 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CPS_2220 (sucB)
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CPS_2220 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2322493..2323968
Genome map
AA seq 491 aa AA seqDB search
MTTEIKVPVLPESVADATVATWHVQVGEKFTRDQVLVDIETDKVVLEVPATCDGVMTDIS
QADGATVLGDQVIGSFSEGSEAAAPAPVAAASAPAASGAVKVIDIVVPVLPESVADATVA
TWHVAEGDTVSVDQNLVDIETDKVVLEVVAQDNGVIGKIIHVEGDTVLGAQKIGELNAGA
TAGSAATAAPIEDAVSSDDLASPSVRRLMTEKGLTAATVVGTGKGGRISKEDVEAAANKP
AAAPKAVAPVAAPVQELGERTQKRVPMTRLRKTIATRLLEAKNSTAMLTTFNEVNMKPIM
DLRKQYKDLFEKTHDTRLGFMSFYVKAVTEALKRFPAVNASIDGDDIVYHNFFDISIAVS
TPRGLVTPVLRDSDQLSMAGIENGIRELAIKGRDGKLSMADMTGGNFTITNGGVFGSLLS
TPILNLPQAAILGMHKIQDRPMAVDGKVEILPMMYLALSYDHRLIDGKESVGFLVTIKEL
LEDPTRLLLDV
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgaaatcaaagttccggtattacctgaatcagttgctgatgcaacagtagca
acttggcatgtacaagttggtgaaaaatttactcgtgatcaagtacttgtagatattgaa
acggacaaagtagtattagaagttcctgcaacttgcgacggtgttatgaccgatattagc
caagctgacggtgctactgtattaggcgaccaagtgattggtagcttttcagaaggcagt
gaagctgctgcacctgcacccgttgcagcagcaagcgctccagcggcatcaggagctgtt
aaagtaatcgatatcgttgtacctgtattacctgaatcagttgccgatgcaactgttgcc
acatggcatgtagctgaaggtgatactgtatcagttgaccaaaacttagttgatattgaa
acagataaagtagtactagaagttgttgctcaagataatggcgtaattggtaaaattatc
catgttgaaggcgatactgttttaggcgctcaaaaaattggcgaacttaatgccggcgca
actgcaggttctgctgctaccgctgcaccaattgaagatgcagtaagttcagatgatctt
gctagcccttcagtacgtcgtttaatgactgagaaaggcttaacggctgccaccgttgtt
ggtactggtaaaggtggacgtatttcaaaagaagacgttgaagccgctgctaacaaacct
gctgctgcaccaaaagcagtagcaccggtagctgcaccagtacaagaacttggcgaacgt
acacaaaaacgtgtgccaatgacgcgtttacgtaaaacgattgcaacacgtttattagaa
gctaaaaattctactgcgatgttaactacgtttaacgaagttaacatgaagccaattatg
gatttacgtaagcaatataaagacttgtttgaaaaaactcatgacactcgtcttggtttt
atgtctttttacgtgaaagcggtaactgaagcattaaaacgattcccagcagtaaatgcc
tcaattgacggtgatgacattgtttatcataacttctttgatatctctatcgctgtatct
acgccacgtggtttagtaacaccagtattacgcgattctgatcaactaagtatggctggc
attgagaatggaattcgtgagttagctattaaaggtcgtgacggtaaattgtctatggct
gatatgactggtggtaacttcactatcacaaacggtggtgtatttggttcactattatca
acacctattcttaacttacctcaagcagcgattttaggtatgcataaaatacaagaccgc
cctatggcagttgacggtaaagtagaaattttacctatgatgtatttagcattatcttat
gatcaccgcttaattgacggtaaagaatctgttggtttcttagtaacaatcaaagaattg
ttagaagatccaacacgtcttcttttagacgtataa

DBGET integrated database retrieval system