KEGG   Colwellia psychrerythraea: CPS_2221Help
Entry
CPS_2221          CDS       T00258                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00020  Citrate cycle (TCA cycle)
cps00640  Propanoate metabolism
cps00660  C5-Branched dibasic acid metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
Module
cps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPS_2221 (sucC)
   00640 Propanoate metabolism
    CPS_2221 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CPS_2221 (sucC)
Enzymes [BR:cps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPS_2221 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAZ27906
UniProt: Q482S1
Position
2324157..2325323
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSEGFACDTPQEAAEAADKIGGDMWVVKTQVHAGGRGKAGGV
KLVKSKEEIKEFAQHWLGKNLVTYQTDANGQPVAKILVESCTDIANELYLGAVVDRASQR
VVFMASTEGGVDIEKIAEETPELIHQAEIDPLVGAQPYQARELGFKLGLNPTQMKQFVKI
FMGLAKMFEDCDFALLEINPLVITDEGNLHCLDGKIGIDGNAIYRQPKMRAFHDPSQEDE
REAHAAQWELNYVALDGTVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGANKERVSE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LKNSGLDIIAAESLTDAATKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaagcgaaacaattgttcgctgaatacggtttaccagtttct
gaaggtttcgcttgcgatacacctcaagaagctgccgaagcggctgataaaattggcggc
gatatgtgggttgttaaaactcaagtacacgcaggcggacgtggtaaggctggcggtgtt
aagctagttaaatcaaaagaagaaatcaaagagtttgctcaacactggttaggtaagaac
ttagttacttaccaaacagatgcaaacggacagccagtagctaaaattttagttgaaagc
tgtactgatatcgccaacgaattatatcttggtgctgttgttgatagagcttctcaaaga
gttgttttcatggcatctactgaaggcggtgttgacattgaaaagatcgcagaagagact
ccagaattaattcaccaagctgagattgatccactagttggcgctcaaccttaccaagca
cgtgaattaggttttaaacttggtttaaaccctacgcaaatgaagcaatttgttaagatc
tttatgggtcttgctaaaatgtttgaagattgtgatttcgccttattagaaatcaacccg
ttagttattactgacgaaggcaaccttcattgtttagacggcaaaattggtatcgatggt
aatgctatttaccgtcaacctaaaatgcgcgctttccacgatccatctcaagaagatgaa
cgtgaagcacatgcagcacaatgggagcttaactatgtagctcttgatggtactgttggt
tgtatggttaacggtgcaggcctagcaatgggtactatggatatcgttaatttacacggc
ggcaagccagctaacttcctagatgttggcggcggagcaaacaaagaacgtgtttctgaa
gcattcaaaatcatcctttctgacgataacgttaaagctgttttagttaacatctttggt
ggcattgttcgttgtgacatgattgctgaaggtattattggcgctgttaaagaagtaggc
gttaaagtaccagttgttgtacgtttagaaggtactaatgctgaattaggtcgtgaagtt
cttaaaaactctggcttagacatcattgctgctgaatcactaactgatgcagcaactaaa
gttgtagcagctgcggagggcaaataa

DBGET integrated database retrieval system