KEGG   Colwellia psychrerythraea: CPS_2308Help
Entry
CPS_2308          CDS       T00258                                 

Definition
GDSL family lipase/acylhydrolase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cps  Colwellia psychrerythraea
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CPS_2308
Enzymes [BR:cps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CPS_2308
   3.1.2  Thioester hydrolases
    3.1.2.-  
     CPS_2308
Lipid biosynthesis proteins [BR:cps01004]
 Fatty acid synthase
  Component type
   CPS_2308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2407108..2407728)
Genome map
AA seq 206 aa AA seqDB search
MTRFILKSIIILILTNLSFTSMANDKILLIGDSLSAGYGLEQAQAWVHLLQNKYREDNKP
VTIINTAISGQTTDNALLKIDAWLDAHQPSHVLIELGGNDGIRGFPVKLLQKHLTELVTK
SQQYGAKVALMEIQIPPNLGQRYRKMFTDSYTKVTDQTGAHLMAYFMTDVAIDSSLMLND
NLHPNAKAQPIIRDFMYSEIDKWLQK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgactcgttttatcctaaaatctattattattttaattttgacaaacctatcatttacc
agcatggcaaatgataaaattttacttattggtgacagcttaagcgctggctatggactt
gagcaagcacaagcatgggttcatttgttacaaaataaatatagagaagataataaacct
gtcaccatcataaatacagcgatcagtggtcaaactacggataatgccttattaaaaatt
gatgcttggcttgacgctcaccagcctagccatgtgctaattgaattgggtggtaatgat
ggtatcagaggttttccagtgaagttattgcaaaaacatttaactgagctggtgaccaag
agtcaacaatatggcgcgaaagtcgctttaatggaaattcaaatccccccgaacttgggc
caaagataccgtaaaatgtttactgatagctataccaaagtgaccgatcaaacgggcgcc
catcttatggcttactttatgacagatgttgccattgattcttcgctaatgctcaatgat
aacttacaccccaatgcaaaagcacaacctatcatccgtgattttatgtatagcgaaatt
gataaatggttacaaaagtaa

DBGET integrated database retrieval system