KEGG   Colwellia psychrerythraea: CPS_2390Help
Entry
CPS_2390          CDS       T00258                                 

Gene name
glk4
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00010  Glycolysis / Gluconeogenesis
cps00052  Galactose metabolism
cps00500  Starch and sucrose metabolism
cps00520  Amino sugar and nucleotide sugar metabolism
cps00521  Streptomycin biosynthesis
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
Module
cps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cps_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_2390 (glk4)
   00052 Galactose metabolism
    CPS_2390 (glk4)
   00500 Starch and sucrose metabolism
    CPS_2390 (glk4)
   00520 Amino sugar and nucleotide sugar metabolism
    CPS_2390 (glk4)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CPS_2390 (glk4)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CPS_2390 (glk4)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CPS_2390 (glk4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAZ26700
UniProt: Q482B0
Position
2504932..2505888
Genome map
AA seq 318 aa AA seqDB search
MVADIGGTNIRLAIASPSDVITDIATYQCAKFANLIDVIRLYIMEKQLEGKTINACLAIA
CPVDDDYISMTNLPWQFSQKDLKEQLKLNTLTLINDYTAIALAIPYLSDSQKVKIGAGEA
VSNKAISVCGPGTGLGVATLVPLDNKWHCISGEGGHVDFAPVDELEVKVFSYIYAYKKRV
SYEQLLSGYGLEQIYQALVKITNEGKSNNFVAGDLSAEIISTNAINGDCILCKQALEFFC
KVLGSFAGNLALTANSLGGVYIAGGIVPRFIDFIEKSGFRERFETKGRLSSLTQQTPTYV
ITETQPGLLGAAAYLNQL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttggttgctgatatcgggggcacaaacattcgattagccattgcttcaccttcggatgtc
attacggatatagctacttatcaatgtgcgaagtttgctaatttaattgatgtcatccgg
ctgtatataatggaaaagcaacttgagggtaaaactatcaatgcttgtttagccattgcc
tgtccggtagatgatgattacatttccatgaccaatttaccttggcagttctctcaaaaa
gatttaaaagaacaattaaaattaaataccttaaccttgataaacgattacaccgccatt
gctctggctattccttatcttagcgattctcaaaaagtgaaaataggggctggtgaggcg
gttagtaataaagctatctctgtatgcggtcctggaactggcttaggtgtagctacttta
gtgccattagataataaatggcactgtattagtggtgaaggaggacatgtcgattttgcc
cctgttgatgagttggaagtaaaagttttttcttatatttatgcttataaaaaacgggtt
tcttatgaacaattattatctggttatggcttagaacagatatatcaagcgcttgttaag
ataactaatgaaggcaaaagtaataattttgtggccggtgacctttcggctgaaattata
agtactaatgcgattaatggtgactgtattttatgcaaacaagcattagaatttttttgt
aaagtattaggaagttttgctggtaatttagcactaacggctaatagtttaggtggcgta
tatattgctggtggtattgtgcctaggtttatcgactttattgaaaagagtggctttaga
gaacgttttgaaacaaaagggcggttatcctcattaacccaacaaacgccgacttatgtg
ataactgaaactcaacctggccttttaggagccgcagcatatttgaaccaactttag

DBGET integrated database retrieval system