KEGG   Colwellia psychrerythraea: CPS_3232Help
Entry
CPS_3232          CDS       T00258                                 

Definition
aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cps  Colwellia psychrerythraea
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    CPS_3232
   01230 Biosynthesis of amino acids
    CPS_3232
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPS_3232
   00290 Valine, leucine and isoleucine biosynthesis
    CPS_3232
Enzymes [BR:cps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CPS_3232
    2.6.1.66  valine---pyruvate transaminase
     CPS_3232
Amino acid related enzymes [BR:cps01007]
 Aminotransferase (transaminase)
  Class I
   CPS_3232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3360743..3361978
Genome map
AA seq 411 aa AA seqDB search
MKAITKSSKLHNVCYDIRGQVAVEAKRLEDEGHKILKLNIGNPAPFGFEAPDDILKDVIH
NLPNSQGYSESQGIYSARVAVMQYFQQQGIKDVMVDDIFIGNGVSELIVMAMQALLDNGD
EVLIPAPDYPLWTAAVSLSGGKPVHYRCDEQNHWFPDLEDMESKITKKTKAIVLINPNNP
TGAVYSEEVLHAIIALARKHGLIIYSDEIYDKILYDEAKHVPTAALATDVFIITLGGLSK
NYRIAGFRAGWMVISGPKLHAEDYIKGIKLLSSMRMCANVPSQHAIQTALGGYQSINELI
RDDGRLIKQRNVAYKMINDIDGLSCNPAMGALYLFVKVDNKKFNITNDERMVLDLLKQEK
ILLVHGRAFNVKEHNYFRLVFLPHVDELIPALEKLKSFFASYKQVQPSKSA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctattaccaagtcatctaaattacataatgtttgttacgatattagaggacaa
gtagccgtcgaggcgaaacgccttgaagatgaaggtcataaaattcttaagttaaatatt
ggtaaccccgccccttttggctttgaagcccctgatgatattttaaaagatgttatccat
aacttacctaactcacagggttattccgaatctcaaggaatttactctgccagagttgct
gtcatgcaatattttcagcagcaaggtattaaagatgtcatggtcgatgatatctttatt
ggtaatggcgtcagtgaactgattgtgatggcaatgcaagcattacttgataatggcgac
gaagtattgatccctgcacccgattatccattatggactgcagcagtatcactttcaggc
ggtaaacctgtgcattatcgatgtgatgagcagaatcattggtttccagatctagaagat
atggaaagtaaaattacaaaaaaaaccaaagccattgtattgatcaaccctaataatcca
actggtgcggtttattcagaagaggttttacacgctataattgccctagcaaggaaacat
ggtctaataatttatagcgatgagatctacgataaaattctttatgatgaagctaaacat
gtcccaactgctgcattagcgacagatgtgtttatcattacactgggtggtttatcaaaa
aattatcgtattgctggctttagagcgggttggatggtcatttctggtccaaaattacat
gctgaagactatattaaaggcataaaattactctcatctatgcgaatgtgcgccaatgta
ccgagccaacacgccatacaaactgcattaggtggttaccaaagtattaatgaattaatt
cgtgatgacggccgtttaattaagcaacgtaatgttgcttacaaaatgattaatgatatt
gatggtttatcatgtaaccctgccatgggtgctttatatctatttgttaaagtagataat
aaaaaattcaatatcaccaacgatgaacgcatggttttagacttactaaaacaagaaaag
atactattagttcatggtcgagcttttaatgttaaagagcataattattttcgtttagtc
tttttacctcatgttgatgagttaattcctgctcttgaaaagttaaaaagcttttttgct
agctataaacaagttcagccgagtaaatcagcataa

DBGET integrated database retrieval system