KEGG   Colwellia psychrerythraea: CPS_3439Help
Entry
CPS_3439          CDS       T00258                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
cps  Colwellia psychrerythraea
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CPS_3439
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CPS_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3578981..3579361
Genome map
AA seq 126 aa AA seqDB search
MKSKILGMSILAATISFTSLAKGNNEVMMQAAGQEIFKKCSACHSTDTSKNTFGPSLVGV
INRKAASLPRFAYSEALQKSGLTWTEANLRRWMAGNDILVPGTRMRHVQITDLAEQNYLL
AYLKSL
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaaaatattgggtatgtcaattttagcagcgactatctcttttacttcatta
gcgaaaggtaataatgaagtaatgatgcaagcagcagggcaagagatttttaaaaaatgt
agtgcatgtcactcaaccgataccagcaaaaacacatttggtcctagcttagttggcgtt
ataaatcgtaaagccgcatcacttccgcgttttgcctattctgaagcattacagaaatca
gggttaacttggacagaagccaatcttcgtcgatggatggcaggtaatgatattttagtg
ccgggtactcgtatgcgtcatgttcaaattacagacctagccgaacagaactatttattg
gcgtaccttaagtctttatag

DBGET integrated database retrieval system