KEGG   Colwellia psychrerythraea: CPS_3448Help
Entry
CPS_3448          CDS       T00258                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00010  Glycolysis / Gluconeogenesis
cps00051  Fructose and mannose metabolism
cps00562  Inositol phosphate metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
cps01230  Biosynthesis of amino acids
Module
cps_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cps_M00002  Glycolysis, core module involving three-carbon compounds
cps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_3448 (tpiA)
   00051 Fructose and mannose metabolism
    CPS_3448 (tpiA)
   00562 Inositol phosphate metabolism
    CPS_3448 (tpiA)
Enzymes [BR:cps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPS_3448 (tpiA)
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPS_3448 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPS_3448 (tpiA)
  Exosomal proteins of melanoma cells
   CPS_3448 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: AAZ27096
UniProt: Q47YJ8
Position
complement(3583007..3583777)
Genome map
AA seq 256 aa AA seqDB search
MTRQAIVAANWKMNGDSALVDTMVSGLADIELSSHVDVVICPSFPYLSELNQKIKAANLN
EAIHVGSQNVSEHESGAYTGEVSTAMLQNLAINYVIVGHSERRSIFKETSTQVAKKVHAA
LNAGLTPILCIGESEAERATGETETVLSAQIQPVIDEIGIEKFKDVVIAYEPVWAIGTGK
TASSAMAQETHQFIRKFLAQQNEQVADKVPLLYGGSVNAANCEELFAQTDIDGGLIGGAS
LKAEQFKIICSAAKGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactagacaagcaattgtagccgcaaattggaaaatgaacggtgactcagccctagtt
gatactatggtttcagggttggctgatattgaactatcatcgcacgttgatgtggttatt
tgtcctagcttcccatatttatctgaacttaatcagaaaataaaagcagctaacttaaat
gaagctatccatgtaggctcacaaaatgtgagtgaacatgaaagtggtgcttacacaggt
gaagtatccacggctatgttgcaaaacttagctattaactatgtaatagttggtcactct
gaacgtagaagtatctttaaagaaacctctacgcaagttgctaaaaaagttcatgctgca
ttaaatgcaggcttaacacccattttatgtattggtgaaagtgaagcagaacgagcaacc
ggagaaactgaaaccgtgctatcagcgcagattcagccagttatcgatgagataggcata
gagaaatttaaagatgttgttatcgcttatgagccagtttgggccataggaacaggtaaa
acagcatcaagtgcgatggcacaagaaacacatcagtttattcgtaaattcttagctcaa
caaaacgagcaagtagcggataaagtaccattactctacggtggcagcgtaaatgcagct
aactgtgaagaactattcgcacaaactgatatagacggtggtcttatcggcggtgctagt
ttaaaagcggaacaatttaaaattatttgttctgcagcgaaaggaaaatag

DBGET integrated database retrieval system