KEGG   Colwellia psychrerythraea: CPS_3448Help
Entry
CPS_3448          CDS       T00258                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_3448 (tpiA)
   01230 Biosynthesis of amino acids
    CPS_3448 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_3448 (tpiA)
   00051 Fructose and mannose metabolism
    CPS_3448 (tpiA)
   00562 Inositol phosphate metabolism
    CPS_3448 (tpiA)
Enzymes [BR:cps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPS_3448 (tpiA)
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPS_3448 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPS_3448 (tpiA)
  Exosomal proteins of melanoma cells
   CPS_3448 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3583007..3583777)
Genome map
AA seq 256 aa AA seqDB search
MTRQAIVAANWKMNGDSALVDTMVSGLADIELSSHVDVVICPSFPYLSELNQKIKAANLN
EAIHVGSQNVSEHESGAYTGEVSTAMLQNLAINYVIVGHSERRSIFKETSTQVAKKVHAA
LNAGLTPILCIGESEAERATGETETVLSAQIQPVIDEIGIEKFKDVVIAYEPVWAIGTGK
TASSAMAQETHQFIRKFLAQQNEQVADKVPLLYGGSVNAANCEELFAQTDIDGGLIGGAS
LKAEQFKIICSAAKGK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgactagacaagcaattgtagccgcaaattggaaaatgaacggtgactcagccctagtt
gatactatggtttcagggttggctgatattgaactatcatcgcacgttgatgtggttatt
tgtcctagcttcccatatttatctgaacttaatcagaaaataaaagcagctaacttaaat
gaagctatccatgtaggctcacaaaatgtgagtgaacatgaaagtggtgcttacacaggt
gaagtatccacggctatgttgcaaaacttagctattaactatgtaatagttggtcactct
gaacgtagaagtatctttaaagaaacctctacgcaagttgctaaaaaagttcatgctgca
ttaaatgcaggcttaacacccattttatgtattggtgaaagtgaagcagaacgagcaacc
ggagaaactgaaaccgtgctatcagcgcagattcagccagttatcgatgagataggcata
gagaaatttaaagatgttgttatcgcttatgagccagtttgggccataggaacaggtaaa
acagcatcaagtgcgatggcacaagaaacacatcagtttattcgtaaattcttagctcaa
caaaacgagcaagtagcggataaagtaccattactctacggtggcagcgtaaatgcagct
aactgtgaagaactattcgcacaaactgatatagacggtggtcttatcggcggtgctagt
ttaaaagcggaacaatttaaaattatttgttctgcagcgaaaggaaaatag

DBGET integrated database retrieval system