KEGG   Colwellia psychrerythraea: CPS_3526Help
Entry
CPS_3526          CDS       T00258                                 

Gene name
trpB2
Definition
(RefSeq) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00260  Glycine, serine and threonine metabolism
cps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01130  Biosynthesis of antibiotics
cps01230  Biosynthesis of amino acids
Module
cps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS_3526 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPS_3526 (trpB2)
Enzymes [BR:cps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CPS_3526 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAZ24165
UniProt: Q47YC0
Position
3666004..3667266
Genome map
AA seq 420 aa AA seqDB search
MSDTNKNTQETKSNKTRLPAYFGEFGGMYVGELLVPALEQLEQAFIESQTDEAFLTEFNN
LLTKYAGRPTPLTCCRNIVKNPLAKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEII
AETGAGQHGVATAIACSLLGLKCKVYMGAVDCQRQQPNVFRMELMGAEVIPVTAGSGTLK
DAVNEALRDWSANYENAHYLLGTAAGPHPFPTIVREFQKMIGEEAKAQFYDEEGRLPDYV
IACVGGGSNAIGMFHDFIKEEGVKLIGVEAGGKGIDTNEHGATLVAGTKGMLHGNYTYIM
QDDFGQIQESYSVSAGLDYPAVGPQHAFLKDTGRAQYVPINDDEALAAFQALAMNEGIIP
ALESSHALAQALKMAESATEETIYLVNLSGRGDKDLAHVHAILSPEEASSTTKVKHRGEA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatacaaataagaatactcaagagacaaaatcaaataaaactcgcttgcctgcc
tactttggtgagtttggtggtatgtacgttggtgagttattagtccccgcactagagcaa
ttagagcaagcttttatcgagtctcaaaccgatgaagcctttttaaccgagttcaataat
ttattaacaaaatatgctggaagaccaacaccattaacgtgttgtcgtaacattgtaaaa
aaccctctagctaaaatttacttgaagcgtgaggatctattacatggtggagcacataaa
acgaaccaagttttaggacaagctctacttgctaagcgcatgggtaaaactgaaataatt
gctgaaacgggtgctggacagcacggtgttgcaaccgcgattgcctgttcattacttggg
ttgaaatgtaaagtttacatgggcgctgtagattgtcagcgacaacagcctaatgttttt
cgtatggaattaatgggcgctgaagttattcctgtaacggctggctcaggtacattaaaa
gacgctgttaatgaagcactaagagattggtctgcaaattatgaaaatgcacactactta
ttaggtacagctgccgggcctcacccatttcctactatagtgcgtgaatttcaaaaaatg
attggtgaagaagccaaagcacagttttatgatgaagaaggtcgtttacctgattatgtt
atcgcctgtgttggcggtggttcaaatgctatcggcatgtttcacgattttattaaagaa
gagggtgttaagcttattggcgttgaagccggtggtaaaggtattgataccaacgaacac
ggtgcaacacttgttgctggtacaaaaggaatgttgcatggtaactacacctatataatg
caagatgattttggccaaattcaagaatcttactcagtatctgctggtcttgactaccct
gcggttggtccacaacatgcctttttgaaagatactggacgtgctcaatatgttcctatt
aatgatgatgaagcattggcagcatttcaagccttagcaatgaatgaaggcattattcct
gcacttgaatcatctcatgcccttgcccaagcattaaaaatggcagagtctgcaaccgaa
gaaactatttatttagttaacttgtcaggtcgtggcgataaagatttagcccatgtccat
gctattctttcacctgaagaagcttcatccacaacaaaagttaaacacagaggagaggca
taa

DBGET integrated database retrieval system