KEGG   Colwellia psychrerythraea: CPS_3527Help
Entry
CPS_3527          CDS       T00258                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPS_3527 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS_3527 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CPS_3527 (trpA)
Enzymes [BR:cps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CPS_3527 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3667266..3668114
Genome map
AA seq 282 aa AA seqDB search
MSNSNIQQAGARYQASFASLKEKNEQAFIPFVMIGDPNAEQSIAVIKSLIDAGADALELG
IPFSDPSADGLTIQNAALRALGAGINTDICIDILKRVREYAPQIPIGLLLYGNLVFARGI
DAFYRDMSAAGVDSVLIADVPIRESEPFREAALKYGIAPIFIAPPNASDETLREVSSYSR
GYTYVLSRAGVTGVDTAESPKNTVTTTANKLIDSLAKYHAAPPVLGFGISTPQQVKDALK
AGALGAISGSAVVKIIEDNLADESKMLIDLTHFVKDMKAATR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactcaaacattcaacaagctggtgcccgataccaagcctcattcgcgtcatta
aaagaaaaaaatgaacaagccttcatcccttttgtcatgattggcgatcctaatgctgaa
cagtcaattgctgttatcaaaagtttaattgatgctggagctgatgccttagagttaggt
attccattttcggatccaagtgctgatggtttgactattcaaaatgcagctcttcgtgct
ttaggtgctggcatcaacaccgatatttgtattgatatattaaaaagagtaagagaatac
gcgccacagatacctattggtttattgctttatggcaacttagtttttgcacgcggtatt
gatgccttttatcgggatatgagcgcagctggagttgattcagttttgattgctgatgta
cctattagagagagtgaaccgtttagagaagcggcattaaaatacggtattgctcctatt
ttcattgcgcctcctaatgcgagtgatgaaaccttacgtgaagtgtcctcatactctcgt
ggttatacctatgtattaagtcgcgcaggcgtgaccggcgtagacacggcagaaagcccc
aaaaacactgttacgacgacagcaaacaagttaattgatagtttagcaaaatatcatgct
gcgcctcctgtgctaggatttggaatttcaacaccacaacaagttaaagatgccctcaaa
gcaggcgctcttggtgcaattagtggatcggcagtagttaaaatcattgaagataactta
gccgacgaaagtaaaatgctcattgatttaacgcattttgttaaagatatgaaagctgct
acgaggtaa

DBGET integrated database retrieval system