KEGG   Colwellia psychrerythraea: CPS_3643Help
Entry
CPS_3643          CDS       T00258                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K02473  
UDP-N-acetylglucosamine 4-epimerase [EC:5.1.3.7]
Organism
cps  Colwellia psychrerythraea
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPS_3643
Enzymes [BR:cps01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.7  UDP-N-acetylglucosamine 4-epimerase
     CPS_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3786141..3787175)
Genome map
AA seq 344 aa AA seqDB search
MTQFKKIKQELLNSPKTWLITGCAGFIGSNLLETLLLLNQKVVGLDNFATGHQHNFDEVQ
TQVSAEQWQNFYFVKGDIRQLEDCQTALSHYKSGVDYILHQAALGSVPRSIADPLLTNSA
NITGFLTMLTAAKETQVKSFVYAASSSTYGDHPALPKVEDAIGKPLSPYAVTKYVNELYA
DVFHKTYGLNCTGLRYFNVFGKRQDPDGAYAAVIPKWTVAMIANEELLINGDGETSRDFC
FVENAVQANILAATANDAGKNQVYNVALGDRTSLNTLFNSLKVALQANGVDYQKSPTYQD
FRAGDVRHSQADISKAKSLIGFEPEFKIQQGIDKAMPWYIKFLN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatttaaaaaaattaaacaagaactactcaattcaccaaagacttggcttatc
acaggttgtgctggttttattggttcgaatcttttagaaacattacttttattaaatcag
aaagttgtcggtttagataacttcgctacgggtcatcagcacaactttgatgaagttcaa
acacaggtttcggctgagcaatggcaaaatttttattttgttaaaggtgatattcgccaa
ttggaagactgtcaaaccgcgttaagccattacaaaagtggtgttgattatatccttcat
caagcagcgttaggctcagtacctagatcaattgctgatcccctattaactaactcagca
aatattaccggttttttgactatgttaacggcagcgaaagaaactcaagttaaaagcttc
gtttacgctgcatcaagttctacttatggagatcacccagcattacctaaagttgaagat
gctatcggtaaaccgctatctccttatgcagtaactaaatatgtaaatgagctttatgcc
gatgtgtttcataaaacctatggtttgaattgcactggcttacgctactttaatgttttt
ggtaaaagacaagaccctgacggcgcttatgctgcggtaatccctaagtggacagttgca
atgatcgctaatgaagaattacttataaatggtgatggtgaaacgagtcgcgatttctgt
tttgttgaaaatgccgtacaagctaatattttagctgcaacggccaatgatgcaggtaaa
aaccaagtgtataatgttgccctcggtgatagaacgagtttaaataccttatttaatagc
ttgaaagttgccttacaagcaaatggtgttgattatcaaaagtcgccaacgtatcaagat
tttagagcaggtgatgttagacattcacaggctgatatttctaaagcaaaatctttgatt
ggctttgagcctgagtttaaaattcaacaaggtatagacaaagcgatgccttggtatatt
aaattcttgaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system