KEGG   Colwellia psychrerythraea: CPS_3714Help
Entry
CPS_3714          CDS       T00258                                 

Definition
(RefSeq) glycosyl hydrolase, family 30
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00511  Other glycan degradation
cps00600  Sphingolipid metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPS_3714
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPS_3714
Enzymes [BR:cps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CPS_3714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Alpha-L-AF_C Glyco_hydr_30_2 Mfa_like_2
Motif
Other DBs
NCBI-ProteinID: AAZ24552
UniProt: Q47XT9
Position
complement(3865375..3867078)
Genome map
AA seq 567 aa AA seqDB search
MKNKAILIGLISSITLTGCMFQDQGSQVNNKTKEISYHLSTTSEILLTSEAGAKVSPQPN
LTFQQGKAQGKVITIRPDIIKQNILGIGTSFTESSAFVLAHLSKEKRAEVMENIYGEKGA
NFSIARTHIGATDFAVDGKYSYAPVKDDVALSSFSIAVDQDGFKQQDHAGIKDEQFDLLP
MIKQAYEIKSKQSDKDLRIVASAWTAPPWMKDIEDYYIKPTAKNNHQGTGGELKQQYRAT
YADYLIKYLDAYKKEGIDIWGLTPVNEPHGNSGQWESMHFTPKTQSAFIKDHLGPKLKVS
AHEQVKLLIYDQNRDEMEHWTDEILADKETAQYVYGTAVHWYESTNKVNEEVFDRVHNKF
PEFSIIHTEGTIDDLGKDAPEGILDPIRFKESNWFNNDNFWWNENATDWAYTATWAPKPE
EHPIYTPVHRYARNIIVSLDHWLEGWIDWNIVLDSNGGPNHVGNFCGAPIMIDTETGEVY
YTPIYHVLAQFSRTIRPGDKALQVETQLAGLDSDALHASAAMSKSNLVSTQLLNTTKAAI
NFSLQIGDQFVEVSIPANSVQTIQAQL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagcgatactcatcgggctcatatcttctataacgttgactggctgtatg
tttcaagatcaaggatctcaagtgaataacaagacgaaagaaattagttatcatttatca
acaacaagtgaaattctgttaacgagtgaggcgggtgctaaagtttcaccacagccaaac
ttgacctttcaacaaggtaaagctcaaggcaaagtgattaccattagacctgatattatt
aaacagaacatattgggtattggtacttcttttaccgaatcttctgcttttgttcttgcg
catttaagcaaagaaaaaagagcagaagtcatggaaaatatttatggtgaaaaaggggct
aatttttccattgctcgaactcatattggcgcgacagactttgctgtggatggtaagtat
tcttatgcaccagttaaagatgatgtagcactctcgtcttttagtatcgctgttgatcaa
gatggttttaaacagcaagaccatgcaggtattaaagatgagcaattcgatttattgcca
atgatcaaacaagcctatgaaattaaaagtaaacaaagtgataaagatttaagaatagta
gcatcagcatggacagcaccaccatggatgaaagacattgaagactattatattaaacct
acagcgaaaaataaccatcagggaacaggtggggaattaaagcagcaatatagagcaacg
tatgctgattaccttattaaataccttgatgcctataaaaaagaaggcattgatatttgg
ggactaactccggtaaatgaacctcatggtaatagtggtcagtgggaaagtatgcatttc
acgcctaaaacacaaagtgcttttattaaagatcatttgggaccaaaattaaaagtaagt
gctcatgagcaggtaaaattactcatttatgatcaaaatcgtgatgaaatggagcattgg
acagatgaaatattagcggataaagaaacggctcagtatgtttatggtacggcggttcat
tggtatgaaagtacaaataaggttaacgaagaagtctttgaccgcgttcataataaattc
cccgagttttcgattattcacacagaaggcaccattgatgatttaggtaaagatgcacca
gaaggtattttagatcccatccgatttaaagagtctaactggtttaataatgataacttt
tggtggaatgaaaatgcgaccgattgggcatataccgcgacatgggcaccaaagccagaa
gaacacccaatttatacaccagtgcatcgttatgcccgaaacattattgtgagtttagat
cactggcttgaaggctggattgattggaacattgtactcgatagtaatggtggacctaat
catgttggaaacttctgtggtgcaccgattatgatagatactgaaacgggagaggtgtat
tacacgccaatttatcatgtactggctcagtttagtcgaacgatccgccctggcgataaa
gcattgcaagtagaaactcaattagctgggctagatagtgatgcattgcatgcaagtgcg
gccatgagtaaaagcaatttagttagtacacaattgttaaacacaaccaaagcagctatt
aacttttcactacaaattggtgatcaatttgtagaagtgtcaattcctgctaattctgtt
caaacaattcaagctcaattataa

DBGET integrated database retrieval system