KEGG   Colwellia psychrerythraea: CPS_3853Help
Entry
CPS_3853          CDS       T00258                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CPS_3853
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_3853
  Lipid metabolism
   00071 Fatty acid degradation
    CPS_3853
  Amino acid metabolism
   00350 Tyrosine metabolism
    CPS_3853
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CPS_3853
   00626 Naphthalene degradation
    CPS_3853
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CPS_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4021308..4022318)
Genome map
AA seq 336 aa AA seqDB search
MKAAVNHQFKGKLEIEQLDKPTISSHEVLVKIHACGVCHTDLHACHGDWPVKPKMPLVPG
HEGVGEIVEVGDQVSHCKLGDRVGIPWLYSACGHCDYCLTGDENLCLSQQNAGYSVDGSY
AEYCKADGNYVVKIPDGISYVDAAPLFCAGVTTYKALKVSTAKPGEWVAIFGIGGLGHLA
VQYAVAMGLNVIAVDTGEAKLDLAKKLGASLCLDFKRDDVVAKVLAETGGVHASICTAVS
KSGFEQSYKVIRRGGKCVLVGLPPEDMPLPIFDTVLNGVSVVGSIVGTRKDLIECLDFAA
RGKVKAITIEKSLEDINDIFEEMINGEITGRVVMKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttaatcatcaatttaagggtaaacttgaaattgagcaactagacaag
ccaacaatttcaagtcatgaagtattagttaagatccatgcctgtggagtgtgccatacc
gatttacatgcgtgtcacggagactggccggtaaaacctaaaatgccattagtgccgggc
catgaaggcgttggcgaaatagttgaagtaggcgatcaggtcagtcattgtaaattaggc
gaccgcgtaggcattccttggctttatagtgcgtgtggtcattgtgattactgtttaaca
ggtgatgaaaacttatgtttatcgcaacaaaatgctggttattcagtggacggcagttat
gccgaatactgtaaagcagatggcaattatgtggtaaaaattccagatggtattagttat
gttgatgccgctcccttattttgcgcaggtgttactacgtataaagcacttaaagtttct
accgcaaaaccgggtgaatgggtcgctatttttggtatcggtggtttagggcatttagcc
gtacagtatgccgttgccatggggttaaatgttattgcggttgatacaggtgaggccaag
ttagaccttgctaaaaaattgggtgcttcactttgtttagactttaaacgagatgatgtt
gttgctaaggtcctcgctgaaaccggaggcgttcatgccagtatttgcactgcggtaagt
aaaagcggttttgaacaaagctataaagttattcgtcgcggtggtaagtgtgtgttagtt
ggcttaccccctgaagatatgccattacctatttttgatactgtgcttaatggcgttagt
gttgttggctctattgttggcacacgtaaagatttgattgaatgtttagactttgctgcc
cgcggaaaagtaaaagctattactattgaaaagtcccttgaagatattaatgatattttt
gaagagatgataaatggtgaaattactggtcgtgtggtaatgaagttctaa

DBGET integrated database retrieval system