KEGG   Colwellia psychrerythraea: CPS_3853Help
Entry
CPS_3853          CDS       T00258                                 

Definition
(RefSeq) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00010  Glycolysis / Gluconeogenesis
cps00071  Fatty acid degradation
cps00350  Tyrosine metabolism
cps00625  Chloroalkane and chloroalkene degradation
cps00626  Naphthalene degradation
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS_3853
  Lipid metabolism
   00071 Fatty acid degradation
    CPS_3853
  Amino acid metabolism
   00350 Tyrosine metabolism
    CPS_3853
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CPS_3853
   00626 Naphthalene degradation
    CPS_3853
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CPS_3853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAZ26952
UniProt: Q47XF5
Position
complement(4021308..4022318)
Genome map
AA seq 336 aa AA seqDB search
MKAAVNHQFKGKLEIEQLDKPTISSHEVLVKIHACGVCHTDLHACHGDWPVKPKMPLVPG
HEGVGEIVEVGDQVSHCKLGDRVGIPWLYSACGHCDYCLTGDENLCLSQQNAGYSVDGSY
AEYCKADGNYVVKIPDGISYVDAAPLFCAGVTTYKALKVSTAKPGEWVAIFGIGGLGHLA
VQYAVAMGLNVIAVDTGEAKLDLAKKLGASLCLDFKRDDVVAKVLAETGGVHASICTAVS
KSGFEQSYKVIRRGGKCVLVGLPPEDMPLPIFDTVLNGVSVVGSIVGTRKDLIECLDFAA
RGKVKAITIEKSLEDINDIFEEMINGEITGRVVMKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttaatcatcaatttaagggtaaacttgaaattgagcaactagacaag
ccaacaatttcaagtcatgaagtattagttaagatccatgcctgtggagtgtgccatacc
gatttacatgcgtgtcacggagactggccggtaaaacctaaaatgccattagtgccgggc
catgaaggcgttggcgaaatagttgaagtaggcgatcaggtcagtcattgtaaattaggc
gaccgcgtaggcattccttggctttatagtgcgtgtggtcattgtgattactgtttaaca
ggtgatgaaaacttatgtttatcgcaacaaaatgctggttattcagtggacggcagttat
gccgaatactgtaaagcagatggcaattatgtggtaaaaattccagatggtattagttat
gttgatgccgctcccttattttgcgcaggtgttactacgtataaagcacttaaagtttct
accgcaaaaccgggtgaatgggtcgctatttttggtatcggtggtttagggcatttagcc
gtacagtatgccgttgccatggggttaaatgttattgcggttgatacaggtgaggccaag
ttagaccttgctaaaaaattgggtgcttcactttgtttagactttaaacgagatgatgtt
gttgctaaggtcctcgctgaaaccggaggcgttcatgccagtatttgcactgcggtaagt
aaaagcggttttgaacaaagctataaagttattcgtcgcggtggtaagtgtgtgttagtt
ggcttaccccctgaagatatgccattacctatttttgatactgtgcttaatggcgttagt
gttgttggctctattgttggcacacgtaaagatttgattgaatgtttagactttgctgcc
cgcggaaaagtaaaagctattactattgaaaagtcccttgaagatattaatgatattttt
gaagagatgataaatggtgaaattactggtcgtgtggtaatgaagttctaa

DBGET integrated database retrieval system