KEGG   Colwellia psychrerythraea: CPS_3933Help
Entry
CPS_3933          CDS       T00258                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cps00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cps00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cps02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4115971..4117821
Genome map
AA seq 616 aa AA seqDB search
MKALNKKSNKTLNLTLKLTSLAVLAALAGCDGSDGTSGDNGTQGTSSLISQTLVTVGHEQ
CLNGGVQIDSGLDSDSSGILDAGEITTTEFVCKPTVTQMQGSSLTATTNNLWYEQGQNIL
GQAQLNAKSLVNARGKAKNVILFVGDGMGLSTVTAARILAGQQLGKLGEEHELSFDKFPY
SGFAKTYNVDAQTPDSAGTMTAMMSGVKTDAGVIGVAEAIKRGDCATASGNELVTALELA
EIAGKSTGIISTARITHATPAATYAKSAERNWEDISDMPATAIAAGCVDIASQLISFESD
IESRFSGTDVDGIDVVLGGGRRHFLPKDAAYNTADATSSVEGDRTDGRDLTAEWQAQYPT
GSFVIDQAGFDAVDSNATQRLFGLFNESHMQYEADRKNDISGEPSLREMTNKAIDILDNN
KEGFFLMVEAGRIDHGHHAGSAHGALTDTIAFADAVQTAVENTDPEETLIIVTADHSHVF
TMAGYPKRGNPILGKVVSVGKTEPSLAKDGMPYTTLGYTNGKGFRDLGSETDADEGYNGD
AITGRQDLTLVDTNSAGFHQESLVPRGSETHAGEDVGIYAMGPGAHLITGTNEQSVIFHV
MDYAADLVKKAEKAMN
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttaaataaaaaatcaaataaaacattaaatttaacattaaaattaacctca
ttagccgtgttagccgcattagcaggttgtgatggcagcgacggaacaagtggtgataac
ggtacccaaggtacaagcagtttaatcagccaaaccttagttactgttggtcacgaacaa
tgtcttaacggtggcgtacaaattgattcaggcttagatagcgatagctcaggtatttta
gacgcgggtgaaattacaacaacagagtttgtttgtaaaccaacagtgactcaaatgcag
ggttcatcactgaccgcgacgaccaataacctttggtatgaacaaggacaaaatatttta
ggccaagcgcagttaaatgctaaatctttggttaatgctcgcggtaaagcaaagaatgtc
attttatttgtcggtgatggcatgggtttatcaaccgttactgccgcacgtatattagca
ggacagcaattaggaaaattaggtgaagaacacgagttaagttttgataaattcccttac
tctggttttgcaaaaacctacaatgttgatgcacaaacgcctgattctgctggcacgatg
acagcgatgatgtcaggtgttaaaaccgatgcaggcgtcattggtgttgccgaagccatt
aagcgtggcgattgtgctactgcatcaggtaatgaactggttacagcattagaattggct
gagattgcagggaaatcaacgggtattatctctacggctcgtattactcatgcaacgccc
gcagcaacctatgctaaatctgcggagagaaattgggaagatatttcagacatgcctgcc
acagctattgccgctggttgtgttgacatagcgtcgcagcttatcagctttgaaagtgat
attgagagccgtttctccggtactgatgttgatggtatcgacgttgtgctaggtggcgga
agacgccacttcttaccaaaggacgcagcatataataccgctgatgcaaccagttctgtt
gaaggtgatagaactgatggtcgagacttaacggcagagtggcaagcgcaatatccaacg
ggtagtttcgtgattgaccaagcgggttttgatgcagttgatagcaacgctacacaacgt
ttattcggtttgtttaatgaatcacatatgcaatatgaagccgaccgtaaaaatgatatt
tcgggtgaaccttctttacgtgaaatgaccaataaagctattgatatacttgataataat
aaagaaggttttttcttaatggttgaagcgggtcgcatagatcatggccatcatgcaggg
agtgcgcacggagcattaaccgataccatcgcattcgctgatgcagtacaaactgctgtt
gaaaacactgaccctgaagaaactttgattattgttacagccgatcatagtcatgtattt
accatggcaggttatccaaaacgtggtaatccaattttaggtaaagtcgtgagtgtagga
aaaactgaaccaagcttagcaaaggatggcatgccttacaccacattgggttataccaac
ggtaaaggttttagagatttaggctcagaaactgatgccgatgaaggatataacggtgat
gcgataacagggcgtcaggacctcactctggttgatacaaattcagcaggtttccaccaa
gaatctctagtaccaagaggctcagagacacatgcaggtgaagatgtcggtatttatgca
atgggacctggcgctcacttaattaccggcacaaatgagcaaagtgttattttccatgta
atggattatgccgctgacttagtaaaaaaagctgaaaaggcaatgaactaa

DBGET integrated database retrieval system