KEGG   Colwellia psychrerythraea: CPS_4039Help
Entry
CPS_4039          CDS       T00258                                 

Definition
(RefSeq) putative glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00625  Chloroalkane and chloroalkene degradation
cps00680  Methane metabolism
cps01100  Metabolic pathways
cps01120  Microbial metabolism in diverse environments
cps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    CPS_4039
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CPS_4039
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     CPS_4039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 Methyltransf_25 NifU
Motif
Other DBs
NCBI-ProteinID: AAZ26197
UniProt: Q47WX4
Position
4246460..4247656
Genome map
AA seq 398 aa AA seqDB search
MCSNHGNRGVVYTGPGSVEIQDIAYPKLAIGNRKCEHGVILKVVTTNICGSDQHMVRGRT
TAEPGLVLGHEITGMIIEKGSDVEFLDIGDIVSVPFNIACGRCRNCREGNTGICLNVNPG
RAGAAFGYVDMGGWVGGQSEYVMVPYADFNLLKFPDKDQALEKIRDLTMLSDIFPTGYHG
AVTAGVVPGATVYIAGAGPVGLAAAASSQLLGAACVIVGDMNPERLAQARSFGCETIDLR
QDATVPDMIEQILGVPEVDAAVDCVGFEAHSHGCSHHKEQPAIVLNTMMEVTRAGGGIGI
PGLYVTGDPGASTEAAKTGQLSMNFGLGWAKSHYFVTGQCPVMKYHRNLMQAILWDKVQI
AKAVNVKVISLDGAPEGYNAFDKGAAQKFVIDPHSMVV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcaaatcatggaaaccgcggcgttgtttatactggccctggaagtgttgaaatt
caagatattgcctaccctaagcttgccattggcaatcgaaaatgtgagcacggtgttatt
ttaaaagtagtaactaccaatatttgtggcagtgatcaacatatggtacgtggccgtact
accgctgaacctgggcttgttttaggtcatgaaattaccggtatgatcattgaaaaaggc
agcgatgtagagtttttagacattggtgatattgtctctgtaccttttaatattgcttgt
ggtcgctgtagaaactgtcgcgaaggaaacacaggtatttgcttaaacgttaatcctggt
cgcgctggtgccgcctttggttacgttgatatgggcggctgggttggtggtcaatctgaa
tatgtgatggtgccttatgctgacttcaacctgctaaaatttcctgataaagatcaggca
ttagaaaaaattcgtgacttgaccatgctctctgatattttcccaacgggatatcatggt
gctgtaactgctggtgttgttcctggtgccacagtttatattgctggtgctggacctgta
ggtcttgctgctgcagcttcatcacaattacttggcgcggcttgtgtcattgtaggtgat
atgaatccagagcgtctagctcaagctcgtagctttggctgtgaaactatcgatttacgt
caagatgccacagtgccagatatgatagaacaaatattaggtgttccagaagtagatgct
gctgtggattgtgttggttttgaagcccacagccacggttgtagtcatcataaagaacag
cctgcaattgtacttaatactatgatggaagtaacacgtgctgggggtggtatcggtatt
ccagggctttatgtaactggcgatccaggtgcatctactgaagcggctaaaactggccaa
cttagtatgaattttggtcttggttgggcgaaatcacattattttgttaccggtcaatgt
ccagtaatgaaatatcatcgcaacctaatgcaggctattttgtgggataaagttcaaatt
gctaaagcggttaacgtgaaagtcatttcacttgatggtgcacctgaaggttataatgcc
tttgataaaggcgccgcacaaaagtttgtcattgaccctcattcaatggtggtttaa

DBGET integrated database retrieval system