KEGG   Colwellia psychrerythraea: CPS_4039Help
Entry
CPS_4039          CDS       T00258                                 

Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
cps  Colwellia psychrerythraea
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cps01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:cps00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:cps00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4246460..4247656
Genome map
AA seq 398 aa AA seqDB search
MCSNHGNRGVVYTGPGSVEIQDIAYPKLAIGNRKCEHGVILKVVTTNICGSDQHMVRGRT
TAEPGLVLGHEITGMIIEKGSDVEFLDIGDIVSVPFNIACGRCRNCREGNTGICLNVNPG
RAGAAFGYVDMGGWVGGQSEYVMVPYADFNLLKFPDKDQALEKIRDLTMLSDIFPTGYHG
AVTAGVVPGATVYIAGAGPVGLAAAASSQLLGAACVIVGDMNPERLAQARSFGCETIDLR
QDATVPDMIEQILGVPEVDAAVDCVGFEAHSHGCSHHKEQPAIVLNTMMEVTRAGGGIGI
PGLYVTGDPGASTEAAKTGQLSMNFGLGWAKSHYFVTGQCPVMKYHRNLMQAILWDKVQI
AKAVNVKVISLDGAPEGYNAFDKGAAQKFVIDPHSMVV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcaaatcatggaaaccgcggcgttgtttatactggccctggaagtgttgaaatt
caagatattgcctaccctaagcttgccattggcaatcgaaaatgtgagcacggtgttatt
ttaaaagtagtaactaccaatatttgtggcagtgatcaacatatggtacgtggccgtact
accgctgaacctgggcttgttttaggtcatgaaattaccggtatgatcattgaaaaaggc
agcgatgtagagtttttagacattggtgatattgtctctgtaccttttaatattgcttgt
ggtcgctgtagaaactgtcgcgaaggaaacacaggtatttgcttaaacgttaatcctggt
cgcgctggtgccgcctttggttacgttgatatgggcggctgggttggtggtcaatctgaa
tatgtgatggtgccttatgctgacttcaacctgctaaaatttcctgataaagatcaggca
ttagaaaaaattcgtgacttgaccatgctctctgatattttcccaacgggatatcatggt
gctgtaactgctggtgttgttcctggtgccacagtttatattgctggtgctggacctgta
ggtcttgctgctgcagcttcatcacaattacttggcgcggcttgtgtcattgtaggtgat
atgaatccagagcgtctagctcaagctcgtagctttggctgtgaaactatcgatttacgt
caagatgccacagtgccagatatgatagaacaaatattaggtgttccagaagtagatgct
gctgtggattgtgttggttttgaagcccacagccacggttgtagtcatcataaagaacag
cctgcaattgtacttaatactatgatggaagtaacacgtgctgggggtggtatcggtatt
ccagggctttatgtaactggcgatccaggtgcatctactgaagcggctaaaactggccaa
cttagtatgaattttggtcttggttgggcgaaatcacattattttgttaccggtcaatgt
ccagtaatgaaatatcatcgcaacctaatgcaggctattttgtgggataaagttcaaatt
gctaaagcggttaacgtgaaagtcatttcacttgatggtgcacctgaaggttataatgcc
tttgataaaggcgccgcacaaaagtttgtcattgaccctcattcaatggtggtttaa

DBGET integrated database retrieval system