KEGG   Colwellia psychrerythraea: CPS_4095Help
Entry
CPS_4095          CDS       T00258                                 

Gene name
dsbC
Definition
(RefSeq) thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
  KO
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cps  Colwellia psychrerythraea
Brite
Enzymes [BR:cps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPS_4095 (dsbC)
Secretion system [BR:cps02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CPS_4095 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4310099..4310893)
Genome map
AA seq 264 aa AA seqDB search
MFKTFIISALLATFTLPLLLQYTNAAEQTNVPATLAKPVSDQIALDADFLKEKINSSIGL
TVVKVEETALPGIALLVTNQGLFYASYDGEFFIQGKVYNLGSTVKDIGEESLAKVRLEGL
KSFEDNMIVYKAENEKYVVSVFTDITCGYCRKMHEKMADYNARGITFRYLAYPRAGIKDQ
NGNLTQGFKDLRSVWCSEDNATALTKAKSGTGIAYRICEAPIEAQFKFGRQIGVSGTPAI
ILSNGMMVPGYQPPEQLEELLKNT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacattcattattagtgctctacttgccacattcactttacccctgttgttg
caatacaccaatgcagccgaacaaactaatgtaccagctacattggccaagccagtaagt
gatcaaattgcgcttgatgcagattttttgaaagaaaaaattaacagctctataggatta
actgttgttaaagttgaagaaacagcattaccgggtattgctttactcgttaccaaccaa
ggtttgttttatgcaagttatgatggtgagtttttcattcaaggaaaagtctacaattta
ggctctaccgtgaaagatataggcgaagagagcttagctaaagtccgtctagagggattg
aaaagctttgaagataacatgatcgtttacaaagctgagaatgaaaaatacgtggtgtca
gtctttactgatattacctgtggttattgccgtaaaatgcacgaaaaaatggcagactat
aatgctcgcggtatcacctttcgttatttagcttatccacgagcaggtattaaagaccaa
aacggtaacttaactcaaggtttcaaagatttacgttcagtatggtgtagtgaagataat
gcaacagcgttaactaaagctaaatcgggtactggtattgcgtatcgaatttgtgaagca
ccaattgaagctcagtttaaatttggtcgtcaaattggtgtaagcggtacgccagcgatt
atcttatcaaatggtatgatggttcctggttaccaaccaccagagcaattagaagaattg
ttgaaaaacacttaa

DBGET integrated database retrieval system