KEGG   Colwellia psychrerythraea: CPS_4119Help
Entry
CPS_4119          CDS       T00258                                 

Gene name
pdxJ
Definition
pyridoxine 5'-phosphate synthase
Orthology
K03474  
pyridoxine 5-phosphate synthase [EC:2.6.99.2]
Organism
cps  Colwellia psychrerythraea
Pathway
Vitamin B6 metabolism
Metabolic pathways
Module
Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Class
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cps00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4335517..4336257)
Genome map
AA seq 246 aa AA seqDB search
MSELLLGVNVDHIATLRQARGTNYPDPVYAASVAEHAGADGITVHLREDRRHIQDRDIHV
LKQTLHTRMNFEMAVTDEMIAIACDVKPVFCCLVPEKREELTTEGGLDVVGQLDKITKAT
EQLTAAGIAVSLFIDADKAQIDAAVASKAPYIEIHTGHYADLSSEEEQLIELERLTVGIK
YAHNLGLKVNAGHGLNYFNVKPIAAIKEIIELNIGHAIIARAAIDGLDKAVRDMKQLMLE
ARTYNT
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattattattaggtgtaaacgttgaccatattgccactttaagacaggcgcgt
ggtactaattatcctgacccagtttatgctgcaagcgttgcagagcatgccggagcagat
ggtattactgtgcacctgcgcgaagataggcgtcatatccaagatagagatattcatgtt
ttaaaacaaacattacatactcgtatgaactttgaaatggctgtcactgatgaaatgata
gcgatagcttgtgatgtgaaaccagtattttgttgtttagttcctgagaaacgcgaagag
ttgactactgaaggtggtttagatgttgtagggcagttagataagataactaaagcaaca
gagcaattaacagctgcaggtatcgctgtaagtttatttattgatgcggataaagcacaa
attgatgctgcggttgccagtaaagctccttatatagaaatacatacgggacattatgca
gatctaagctcagaagaagagcagctgatagaacttgagcgcctaactgtcggtattaag
tatgcgcataacttaggattaaaagttaatgcaggtcatggtttaaattattttaatgtc
aaacctattgctgctattaaagaaattatcgagttgaatattggccatgccataatagcg
cgtgcggctattgatggcttagataaagctgttagagatatgaaacagctgatgttagaa
gcaagaacttataatacttaa

DBGET integrated database retrieval system