KEGG   Colwellia psychrerythraea: CPS_4289Help
Entry
CPS_4289          CDS       T00258                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cps01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cps00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cps00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4518386..4519690)
Genome map
AA seq 434 aa AA seqDB search
MKYYNLKENDEQVTFAQAVKQGLGKNQGLFFPTDMPKLDNIEELLALPLVERSVKILAPF
VEGDLTKSELTDIVTDAFNFPALLQPISPDRAILELFHGPTLAFKDFGARFMAKCLQVFV
AKDAKASGETKPLTILTATSGDTGAAVAHAFHGIDNIRVVIMYPKGKISLLQEKMFTTLG
GNIETLAVDGDFDDCQTLVKQSFDDKELANTIGLNSANSINISRLLAQVCYYFEAVAQLS
RAKSDLSSIVFSIPSGNFGNLTAGLFAKAMGLPIKRFIAATNANDTVPRYLETGEWTPNV
TVATISNAMDVSNPNNWPRVEHMLKSGIVEQGCVSSVSIDEEQTQSTVIQLRKLGYISEP
HAAVAYKALQYSAVEGEFGVFLGTAHPAKFKEVVESILGQPLGLPKELADCAGEPILSQD
LAANFSDLRSYLLS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatattataatttaaaagaaaatgatgagcaggtaactttcgctcaagcagttaaa
caaggtttaggtaaaaatcagggcttatttttccctaccgatatgccaaaacttgataat
atcgaagagctgctagcactgcctttggtagagcgtagtgttaaaatattagcaccattt
gttgaaggtgacttaacaaaaagtgaattaactgacattgttaccgatgcttttaatttc
cctgctttattacagccgattagcccagaccgtgccattttagaattattccacgggcca
acgttagcttttaaagattttggtgcccgctttatggccaagtgtttacaagtatttgtt
gctaaagatgctaaagcaagtggtgagacaaaacctttgaccattttaaccgctacgtct
ggtgataccggtgcggctgttgctcatgcttttcacggtattgataacattcgtgttgtc
atcatgtatccgaaaggaaaaattagcttactacaagaaaaaatgtttaccacgctaggt
ggaaatattgaaacattagcagtggatggtgattttgatgattgccaaacattagtaaag
cagtcttttgatgataaagaattggcaaatactatcggtttgaattcggcaaactcaata
aacatcagtcgattattggcacaagtatgttattactttgaagcagtagcacaattatca
cgcgcaaagagtgatttaagtagcattgtattctctatccctagtggtaattttggtaac
ctaaccgctggtttatttgccaaagcaatgggcttgccaattaaacgctttattgccgca
actaacgctaatgatacggtgccacgttacttagaaacaggtgagtggacacccaatgta
accgtcgctactatttcaaatgcaatggatgtgagtaacccgaataactggccgcgcgtt
gagcatatgctcaagagtggtattgttgaacaaggttgtgtcagctcagtatctattgat
gaagaacaaacccaatcaaccgttattcaacttcgtaagttaggttacatcagtgaacca
catgctgctgttgcttataaagcgctacaatatagtgctgtagaaggggagtttggtgtc
tttttaggaacagctcatcctgcgaaatttaaagaagttgttgaaagcattcttggtcaa
ccgttaggtttaccaaaagagcttgcggattgtgctggtgagcctatcttgtcgcaagat
cttgctgcaaacttcagtgatttacgtagttatcttttaagttag

DBGET integrated database retrieval system