KEGG   Colwellia psychrerythraea: CPS_4289Help
Entry
CPS_4289          CDS       T00258                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPS_4289 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS_4289 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CPS_4289 (thrC)
Enzymes [BR:cps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CPS_4289 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4518386..4519690)
Genome map
AA seq 434 aa AA seqDB search
MKYYNLKENDEQVTFAQAVKQGLGKNQGLFFPTDMPKLDNIEELLALPLVERSVKILAPF
VEGDLTKSELTDIVTDAFNFPALLQPISPDRAILELFHGPTLAFKDFGARFMAKCLQVFV
AKDAKASGETKPLTILTATSGDTGAAVAHAFHGIDNIRVVIMYPKGKISLLQEKMFTTLG
GNIETLAVDGDFDDCQTLVKQSFDDKELANTIGLNSANSINISRLLAQVCYYFEAVAQLS
RAKSDLSSIVFSIPSGNFGNLTAGLFAKAMGLPIKRFIAATNANDTVPRYLETGEWTPNV
TVATISNAMDVSNPNNWPRVEHMLKSGIVEQGCVSSVSIDEEQTQSTVIQLRKLGYISEP
HAAVAYKALQYSAVEGEFGVFLGTAHPAKFKEVVESILGQPLGLPKELADCAGEPILSQD
LAANFSDLRSYLLS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatattataatttaaaagaaaatgatgagcaggtaactttcgctcaagcagttaaa
caaggtttaggtaaaaatcagggcttatttttccctaccgatatgccaaaacttgataat
atcgaagagctgctagcactgcctttggtagagcgtagtgttaaaatattagcaccattt
gttgaaggtgacttaacaaaaagtgaattaactgacattgttaccgatgcttttaatttc
cctgctttattacagccgattagcccagaccgtgccattttagaattattccacgggcca
acgttagcttttaaagattttggtgcccgctttatggccaagtgtttacaagtatttgtt
gctaaagatgctaaagcaagtggtgagacaaaacctttgaccattttaaccgctacgtct
ggtgataccggtgcggctgttgctcatgcttttcacggtattgataacattcgtgttgtc
atcatgtatccgaaaggaaaaattagcttactacaagaaaaaatgtttaccacgctaggt
ggaaatattgaaacattagcagtggatggtgattttgatgattgccaaacattagtaaag
cagtcttttgatgataaagaattggcaaatactatcggtttgaattcggcaaactcaata
aacatcagtcgattattggcacaagtatgttattactttgaagcagtagcacaattatca
cgcgcaaagagtgatttaagtagcattgtattctctatccctagtggtaattttggtaac
ctaaccgctggtttatttgccaaagcaatgggcttgccaattaaacgctttattgccgca
actaacgctaatgatacggtgccacgttacttagaaacaggtgagtggacacccaatgta
accgtcgctactatttcaaatgcaatggatgtgagtaacccgaataactggccgcgcgtt
gagcatatgctcaagagtggtattgttgaacaaggttgtgtcagctcagtatctattgat
gaagaacaaacccaatcaaccgttattcaacttcgtaagttaggttacatcagtgaacca
catgctgctgttgcttataaagcgctacaatatagtgctgtagaaggggagtttggtgtc
tttttaggaacagctcatcctgcgaaatttaaagaagttgttgaaagcattcttggtcaa
ccgttaggtttaccaaaagagcttgcggattgtgctggtgagcctatcttgtcgcaagat
cttgctgcaaacttcagtgatttacgtagttatcttttaagttag

DBGET integrated database retrieval system