KEGG   Colwellia psychrerythraea: CPS_4341Help
Entry
CPS_4341          CDS       T00258                                 

Gene name
folK3
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cps  Colwellia psychrerythraea
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4574428..4574925
Genome map
AA seq 165 aa AA seqDB search
MAQIYISLGSNINREHYVKQGLLSLAKVFELPFEQLTLSSLFESKAVGFDGAAFYNMVIG
IKCTQNVEEVASMLRAIEFSHGRDHNAKKFSPRSLDLDLLLFDDLIINEPAQLPRDEIIK
NAFVLWPLSQVAPELTHPIVKQTYRDLWQGYNKTSQQLSIVANCW
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatctatatttcattaggcagcaacattaaccgtgagcattacgttaagcaa
ggtctactctcattagctaaagtatttgagctgccttttgaacagttaacattatcttcc
ttatttgaaagcaaggccgttggttttgatggtgctgctttttataatatggtgataggc
atcaaatgcacacaaaatgtcgaagaagtggcgagtatgttacgcgccatagaattttct
cacggccgtgaccataacgcgaagaagtttagcccgcgtagcttagatcttgatttgtta
ttgtttgatgatttaattattaacgaacctgcgcaactgcctcgagatgaaataattaaa
aacgcctttgttttatggccattgagtcaagttgcacctgagcttacccacccgattgta
aaacaaacttatcgagatttatggcaaggttataataaaaccagtcagcaacttagcata
gtagctaactgctggtag

DBGET integrated database retrieval system