KEGG   Colwellia psychrerythraea: CPS_4422Help
Entry
CPS_4422          CDS       T00258                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cps  Colwellia psychrerythraea
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cps00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cps00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cps02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4663266..4664375
Genome map
AA seq 369 aa AA seqDB search
MKSSSFVLLCMTSFSLFITAQATQLNQLLHLDRSDKLKNSPQKILFGSCSHQDKAMPILK
SINNEAADLFIFLGDNIYGDTKNMQDMADKYQRLGNNPDIQALRSATPTIAIWDDHDFGE
NDAGAEYPQKEQSRKLMLDFWQEPQNSARYTQKNGIYTAYMYGEEHNKVHVILPDLRWNR
DKLSSVDRLNYQTKRKPKNMGPYSPSSLKNASMIGETQWQWLEKELQKPSKIKVIASSLQ
LLPEFTGWESWANFPHDRERLFALIKKHQVNGIIIISGDTHWGEMSKVSDKLDYPLWEVT
SSGLTEEWKEVSPNKHRIGNFINKVNYGELLIDWQQVDPQITLNLKDVDGKVFSQQKMPL
SSISPYHKQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatcatcatttgttctactatgtatgaccagctttagcctattcataaccgca
caagctacgcaattaaatcagttacttcacttagataggtcagataagttaaagaactca
ccacaaaaaattctttttggctcctgttcacatcaagacaaagctatgcctattttaaag
tctattaataatgaggctgcagatttattcatttttctgggtgataatatttatggtgat
acaaaaaacatgcaagacatggccgacaaatatcaacgtctaggtaataatccagacata
caagcactgcgctcagccacaccaaccatcgccatttgggatgaccatgactttggtgaa
aatgatgcaggtgctgaatatcctcaaaaagaacaatcaagaaagttaatgttagacttc
tggcaagaaccacagaattcagccagatatactcaaaaaaatggtatttacactgcttat
atgtatggagaagaacacaataaagtgcatgttattttacctgatttacgctggaacaga
gataaattgagcagtgtcgatagactaaattaccaaacaaaacgtaagccgaagaatatg
ggaccttatagtcctagctcactaaaaaacgcctcaatgattggtgaaactcaatggcaa
tggttagaaaaagaattacaaaaaccatcaaaaattaaagtgattgcctctagtttacag
ctattacctgaatttactggttgggagtcttgggccaattttcctcatgacagagaacgc
ctttttgctttaattaaaaagcaccaggttaatggcatcataatcattagtggtgatacc
cattggggagaaatgtctaaggtatcagacaagctagattatccattatgggaagtaaca
agttcaggcttaacggaggagtggaaggaagtaagccctaacaaacatcgcataggaaac
tttattaacaaagtaaattacggtgagttactcattgattggcagcaagtcgacccgcaa
ataacgctgaacttaaaagacgtagatggcaaagtatttagtcagcaaaaaatgccgtta
tcttcgattagtccataccataaacaataa

DBGET integrated database retrieval system