KEGG   Colwellia psychrerythraea: CPS_4864Help
Entry
CPS_4864          CDS       T00258                                 

Definition
xanthine dehydrogenase, iron-sulfur binding subunit
Orthology
K13481  
xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
cps  Colwellia psychrerythraea
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cps00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5157565..5159049
Genome map
AA seq 494 aa AA seqDB search
MVANTIKFLLNNELVKIENLDPNTTVLQYLREERFKSGTKEGCASGDCGACTVVLAELDP
KKTGQLIYKSINSCITFVGNLHGKQLITVEDLKEGAQLHHAQQTIVDNHGSQCGFCTPGF
VMSSFALHKQNNTPNRAEVLEALAGNLCRCTGYRSIIEAAITSSESAAEDSFAKHYQATV
TALTALKKLSAPALTGNSHNYIAPKNIDELATELTNEPKSTLVAGGTDLALSVTQNLATI
DKLVYVGNVAELTTIEETETEIIIGSALPYSEFIDTLHHYYPDLGEMIERIGSKQVRNTG
TLGGNVGNASPIGDMPPALIALGATMTLHVQGQERTILVEDYFVDYKKTVLKPSEFIKSI
QIPKPTAGQTLKLYKISKRIDDDISAVLAAFFIEQEVDGNGQKITNVRLAFGGMAAIPKR
APATEAILLGNSLTKALVAQAKEALTTDFQPMSDVRASDKYRMTVAQNLIEKCYLELQSA
NAREVIETRVVNYA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtagcaaatacaataaaattcctgttaaacaacgagctagtaaagattgagaactta
gatcctaatacgactgttttacaatacttacgtgaagagcgatttaaatctggcacaaaa
gaaggctgtgcttcaggtgattgcggggcttgtaccgtagtactcgctgaactagatcct
aaaaagactggtcaactaatttataaatcaattaactcctgcattacctttgttggtaat
ttacatggcaagcaattgattactgttgaagacttgaaggaaggcgctcagttacatcac
gcccagcaaacaattgttgataaccacggttcacaatgtggattctgtacccctggattt
gttatgtcgtcttttgctttgcataagcaaaacaacacaccaaatcgtgctgaggtatta
gaagcattagccggtaacttgtgtcgttgtactggttaccgctcaattatcgaagcggcc
atcacgtctagcgaaagtgcggcagaagattcatttgctaagcactatcaagcaaccgtt
actgcgctaacagcattaaaaaaattatcagcgcctgcattaacaggtaatagccataac
tatattgcgccaaaaaatatcgatgagttggcgactgagttaaccaatgagcctaaatcc
acattagtggctggtggcaccgatttagccctttctgttacacagaatttagcaacgatt
gataagcttgtttatgtcggtaatgttgcagaattaacgactatcgaagaaacagaaact
gagattattattggctctgcactaccttacagtgaatttatcgatacattgcatcattac
taccctgatttaggggaaatgatcgaacgtatcggttctaagcaagtacgtaataccggt
actttaggcggcaacgttggtaatgcctcacctattggtgatatgccaccagcgttaatc
gctttaggtgcaaccatgacactgcatgttcaaggtcaagaacgtaccatcttagttgaa
gactattttgtcgactataagaaaactgtgcttaagccatctgaatttattaaatcaatt
caaatccctaaacctaccgcggggcaaacgttaaaactttacaaaatttctaagcgtatt
gatgacgatatctcagcggtattagcggcctttttcatcgagcaagaggttgatggaaac
ggtcaaaagattactaatgtccgtttagcttttggtggcatggctgctattcctaaacgt
gcacctgcgactgaagccatattgttaggcaatagcttaacaaaagcgttagtagcgcaa
gcaaaagaagcgttaacgaccgatttccaaccaatgtcagatgttcgtgcttctgataag
taccggatgaccgtagctcaaaacctgattgaaaaatgttatttagagttgcagagcgcc
aatgcaagagaagttatagaaacacgagtggtaaattatgcgtag

DBGET integrated database retrieval system