KEGG   Colwellia psychrerythraea: CPS_4874Help
Entry
CPS_4874          CDS       T00258                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cps  Colwellia psychrerythraea
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPS_4874
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPS_4874
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_4874
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CPS_4874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5169617..5171806
Genome map
AA seq 729 aa AA seqDB search
MKQRTIKHGYKVAGCLYNLVNHEVLPGLNIHADDFWNSVAEVLAEFTPRNQQLLATRANL
QAHIDVWHTDPANQPFNQQRYELFLKEIGYLVTEKADFTISTQNVDDEVALIAGPQLVVP
LMNARFSLNAANARWGSLYDALYGTDVIGDDNGAKQTKDFNPIRGRRVQAYARRFLDETL
PLTRGSHIDAVKYHIVKKAFTVTLFTGEQVQLKEAQQFVGYKGSTAAPSILLCRHNGLHI
EIQIDKDNVVGKTDAAAVKDVVLESALSTIQDCEDSIAAVDASDKTSVYRNWLGLMKGDL
AEIIQKGSRTITRTLNHDRNYLSPDQKEITLPGRSLQFIRNVGHLMTTNAIVTAKNEKVP
EGIVDGLITSLISLHDLKGTSKFKNSKQGSIYIVKPKMHGPEEVAFSHDLFSAIERHLGL
AQNTIKMGIMDEERRTSANLKECIRAAQTRLAFINTGFLDRTGDEIHTSMHAGAMAQKAL
MKDEPWITAYENRNVRIGLQAGLQGKAQIGKGMWAIPDQMSEMVKSKIAHPKSGANCAWV
PSPTAATLHVMHYHKVNVQEIQSAMQAEFSLPGTIDDLSELLTIPLLKNQTELSTAAIQK
ELDNNIQGLLGYVVRWVNQGIGCSKVPDIDNIARMEDRATLRISSQHVCNWLHHGVISDS
QVLESLQRMAEVVDQQNAADSSYIAIGTDFGESIAFKAAKDLIFQGKEQPSGYTEPLLHQ
RRQEVKAMY
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagaacaatcaagcacggttataaagttgcaggctgcttgtataatttagtc
aaccatgaagtattaccgggtcttaacattcatgccgatgacttttggaattctgttgct
gaggtgttagctgagtttactccgcgtaatcaacagctattagcgacaagagctaattta
caagcgcatattgatgtttggcatactgatcccgccaatcagccttttaaccaacagcgc
tatgagttgtttttaaaagaaataggatatttggtcaccgagaaagcagattttactatc
tctactcaaaatgttgatgatgaggttgcccttattgcgggccctcaactggtagtgccc
ttgatgaatgcacgattttcccttaatgccgcgaacgcacgatggggtagcttgtatgac
gctttatatggtaccgatgttattggtgacgataatggcgcgaaacagactaaagatttc
aatcctattcgcggacgtagagtgcaagcatacgcgcgcagatttttagatgaaacttta
ccgttaacccgtggtagtcatattgatgcggtgaagtaccatatcgtcaaaaaagccttt
actgtgacccttttcactggtgaacaagtgcagttaaaagaggcacaacagtttgttggc
tacaaaggatctaccgctgctccctctatcctactttgccgtcataatggtctacacatt
gagatccaaatagataaagacaatgttgtcggcaagaccgatgccgctgctgttaaagat
gtagtattagagtcggcgttaagtactattcaagactgtgaagactctattgccgcggta
gatgcctcggacaaaacctcggtttatcgtaactggttaggtttaatgaaaggcgacctt
gctgagattattcaaaaaggcagtagaaccatcacccgtaccttaaaccatgaccgcaac
tatttatcgcctgaccagaaagaaatcaccctgccaggaagaagcctgcaattcattcgt
aatgtaggtcacttaatgaccacaaatgctattgtcacagcaaagaatgaaaaagtacct
gaaggcattgttgatggcctcatcaccagtttaatttcactgcacgatttaaagggcacc
tcgaaattcaaaaactctaaacaaggcagtatttacattgtaaaacctaaaatgcatggc
cctgaagaagttgcctttagccatgatttgtttagtgccattgaacgtcatttgggctta
gcccaaaacaccataaaaatgggtatcatggatgaagaacgtcgcacttctgccaattta
aaagagtgtatacgcgccgcacaaacacgccttgcgttcattaacactggctttttagac
cgcaccggtgatgaaattcataccagtatgcatgcgggcgctatggctcaaaaagccttg
atgaaagatgaaccctggataacagcctatgaaaatagaaatgtaagaattggtttgcaa
gcaggcctgcaaggtaaagcgcaaattggtaaaggcatgtgggcaataccggatcaaatg
tcggaaatggttaaaagtaaaatagcccatccaaaatcgggggcaaattgtgcttgggtt
ccctcgccaactgccgctacgttacacgtaatgcattaccacaaagtcaatgttcaagag
attcaaagtgccatgcaagccgagttttctttaccgggaactattgatgatttaagtgag
ttattgactatccctttacttaaaaatcaaaccgaattatcaacagcggcaattcaaaaa
gaactagacaataacattcaaggtttattggggtatgtggttcgttgggtgaatcaaggc
attggttgctccaaagtacctgatatcgacaatatagcccgcatggaagatagagcaacc
ttacgaatatcaagtcaacatgtttgcaactggcttcatcatggtgtgatcagtgacagc
caagtacttgaatcactacagcgcatggctgaagttgttgatcaacaaaatgctgccgat
agcagctacattgctattgggacagattttggggaaagtattgcttttaaagctgccaag
gatcttattttccaaggcaaagagcagccaagcggctataccgaaccgttattacaccaa
agacgccaagaagttaaagccatgtactaa

DBGET integrated database retrieval system