KEGG   Colwellia psychrerythraea: CPS_4971Help
Entry
CPS_4971          CDS       T00258                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00230  Purine metabolism
cps01100  Metabolic pathways
Module
cps_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPS_4971 (gmk)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPS_4971 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin RsgA_GTPase MMR_HSR1 AAA_16 AAA_35 AAA_22 AAA_33 AAA_29 ABC_tran Dynamin_N CPT cobW AAA_23 AAA_18
Motif
Other DBs
NCBI-ProteinID: AAZ24463
UniProt: Q47UB3
Position
5281490..5282146
Genome map
AA seq 218 aa AA seqDB search
MIVPGNLFILSAPSGAGKSSLINALLKPDNQASARAMQVSISHTTRDARPGENNGEHYHF
VSVEEFKKQISLNAFYEYAEVFGNYYGTSEAAIDAQLSQGIDVFLDIDWQGAQQVRMKKP
GVTTIFISPPSKEELESRLRGRGQDSDEVIASRMAQAQAECSHYNEFDYVIVNDDFEQAL
LDLTTIVNNQRLKCRQQSIAQQSLFSKLLNIEAVEPTE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgattgttcccggtaatttatttattctttctgcgccaagtggcgcaggaaaatcaagc
cttatcaatgccttgctaaaacctgataatcaagcctccgcaagagccatgcaggtatct
atttctcataccacgcgagatgcccgccctggtgagaataatggcgaacattatcacttt
gttagcgttgaagaatttaaaaagcaaatcagcctcaacgccttttatgagtatgctgaa
gtatttggcaactattacggcacttctgaagcagctattgatgcgcaactttctcaaggt
attgatgtttttctcgatattgattggcaaggtgctcagcaagttcgtatgaaaaaacct
ggcgtaacaactatttttattagcccgccgtctaaagaagagttagaaagtcgcttaaga
ggtcgtggccaagacagtgatgaagtcattgctagtcgtatggcacaagcgcaagctgaa
tgttctcattataatgaatttgattacgtcattgttaatgacgatttcgagcaagccttg
cttgatctcactactattgtaaataatcagcgtcttaaatgtcgtcagcaaagcatcgcg
cagcaaagtttatttagtaagttgctaaacattgaagccgtggagccaactgaatag

DBGET integrated database retrieval system