KEGG   Chlamydophila psittaci Mat116: AO9_01435Help
Entry
AO9_01435         CDS       T02450                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpsa  Chlamydophila psittaci Mat116
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpsa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287570..289708
Genome map
AA seq 712 aa AA seqDB search
MVERIVNSEDVSLLISGRQSNPHKFLGIVSENSSQDRIILFRPGAHSVVVELQGNIAHAQ
HHHSGIFSLTAPKGTLPQDYRIYHQNGLLAHDPYAFSPLWGEVDSFLFHQGTHYKIYERM
GAIPYDVQGISGVLFVVWAPHAQRVSVVGDFNFWNGLVNPLRKVSDLGVWELFIPGLEEG
TLYKWEIVSASGEVLIKTDPYGKSFDAPPHAVSRVVHSDRYTWHDAQWMEKRKNREDQPL
AIYEVHVGSWQWHEGKPLGYRELAKKLAAYCKEMHYTHVELLPVTEHPLNESWGYQVTGY
YAPTFRYGSPEDFQFFVDHLHSENIGVILDWVPGHFPTDGFALAHFDGEALYESIEHKEP
LHPHWHTYTFDYRCNEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRQEGEWSPN
IYGGRENLDAIEFLKHLNSVVHREFPGVWTFAEESTDFPNVTKPVAQGGLGFDYKWNLGW
MHDTFRYIQVDPMFRSYHHNDLTFSLWYAFNERYLLPLSHDEVVHGKGSLLQKMPGDNPW
TKFAHMRLLLSYHICQPGKKLLFMGGEFAQGKEWAPDSSLDWHLLDNSYHACLHRCVARM
NALYCDLPYFWKGDGKQESFHWVDFKDTENNVIAYYRFAGENRSSALLCIHHFSSGYFPS
YVLHCQDINTCQLLFNSDDICFGGSGKGNRQPVLCIDQHVSWGVDIELAPSS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaggattgtcaactctgaagacgtgtccttattaatttctggaaggcagagt
aatcctcataagtttttagggattgtttctgaaaactcctcacaggatagaatcattctc
tttcgtcctggggcccattctgtagttgtcgaactgcagggaaatatagcgcatgcacaa
caccatcattcggggatattttctctaactgctcctaaggggactctccctcaggattat
cgtatctatcatcaaaatggcctattagctcacgatccttatgcgttttctcctttgtgg
ggagaagtagattcttttttatttcatcaaggtacgcactataagatttacgaacgtatg
ggagcgattccctatgatgttcagggaatttccggggtgctttttgtggtttgggctcca
catgcacaacgcgtatctgttgtcggtgattttaatttttggaatggtcttgttaatcct
ttgcgcaaagtctctgatttaggagtttgggaattatttatcccaggtcttgaagaagga
accctgtataaatgggaaattgttagcgcttccggagaggtgcttatcaaaactgaccct
tatgggaaaagttttgatgctcctcctcatgcagtatctcgcgttgtgcatagtgatcgc
tatacatggcatgacgcccagtggatggaaaaacgtaaaaacagagaagaccagccttta
gcaatttatgaggtgcatgtaggttcatggcagtggcatgagggtaaacctttaggatac
cgagagttagcaaagaaactcgctgcctattgcaaagagatgcattatacgcacgttgag
ctgttgccagttacagaacatcctttaaatgaatcttggggataccaagtaacaggatac
tacgcacctacatttcggtatggatcacctgaagattttcagttttttgtagaccacctt
catagtgaaaatatcggggtgattttagattgggtgcctgggcacttccccacggatggc
tttgctttagctcattttgacggagaagccctgtatgaatctatagaacataaagagcca
ttacacccccattggcatacgtatacttttgattatcgctgcaatgaagtcgtgaatttc
cttttaggcagcgctctattttggttagataaaatgcacatagatggtttacgtgtcgat
gctgtaacctcgatgttgtatttagattatggccgtcaagaaggagagtggtcccccaac
atctatggaggtagagagaatctcgatgctatcgagttcttgaaacacttgaattctgta
gtgcatagggaattccccggggtatggacatttgctgaggaatctacagatttcccgaac
gtgaccaagccggtcgcccaaggagggttagggttcgattataaatggaacttaggttgg
atgcacgatacctttcgttatattcaggtcgatcctatgttccgttcgtatcaccataat
gatctgacctttagcctttggtatgcctttaacgaaaggtacctccttcctctttctcat
gatgaggttgtccatggtaaaggtagccttttacaaaaaatgcctggtgataatccatgg
acaaagtttgcccatatgcgtttgctgttaagctatcacatatgccagccgggcaagaaa
ctgctgtttatgggtggggaatttgctcaaggaaaagaatgggctccggatagctcttta
gattggcatctgttagataactcctatcacgcttgtttacacaggtgcgtagcacggatg
aatgctttatattgtgaccttccttatttttggaaaggagatggtaagcaggagtctttc
cattgggtagacttcaaagatactgaaaataatgttatagcttactacagatttgcagga
gaaaatcgtagtagcgctttactgtgtatccaccattttagttcgggatattttccttct
tacgttctacattgtcaggacataaatacctgccaactcctttttaatagcgatgatatt
tgctttgggggttcagggaaaggcaaccgtcagccagttctttgcatagatcagcatgtc
tcttggggggtggatatcgagctcgccccctctagctaa

DBGET integrated database retrieval system