KEGG   Chlamydia psittaci 84/55: B595_0304Help
Entry
B595_0304         CDS       T02308                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cpsb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B595_0304 (glgB)
Enzymes [BR:cpsb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     B595_0304 (glgB)
Exosome [BR:cpsb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B595_0304 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287781..289607
Genome map
AA seq 608 aa AA seqDB search
MGAIPYDVQGISGVLFVVWAPHAQRVSVVGDFNFWNGLVNPLRKVSDLGVWELFIPGLEE
GTLYKWEIVSASGEVLIKTDPYGKSFDAPPHAVSRVVHSDRYTWHDAQWMEKRKNREDQP
LAIYEVHVGSWQWHEGKPLGYRELAKKLAAYCKEMHYTHVELLPVTEHPLNESWGYQVTG
YYAPTFRYGSPEDFQFFVDHLHSENIGVILDWVPGHFPTDGFALAHFDGEALYESIEHKE
PLHPHWHTYTFDYRCNEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRQEGEWSP
NIYGGRENLDAIEFLKHLNSVVHREFPGVWTFAEESTDFPNVTKPVAQGGLGFDYKWNLG
WMHDTFRYIQVDPMFRSYHHNDLTFSLWYAFNERYLLPLSHDEVVHGKGSLLQKMPGDNP
WTKFAHMRLLLSYHICQPGKKLLFMGGEFAQGKEWAPDSSLDWHLLDNSYHACLHRCVAR
MNALYCDLPYFWKGDGKQESFHWVDFKDTENNVIAYYRFAGENRSSALLCIHHFSSGYFP
SYVLHCQDINTCQLLFNSDDICFGGSGKGNRQPVLCIDQHVSWGVDIELPPLATLIFYVR
FVNKQSLV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgattccctatgatgttcagggaatttccggggtgctttttgtggtttgggct
ccacatgcacaacgcgtatctgttgtcggtgattttaatttttggaatggtcttgttaat
cctttgcgcaaagtctctgatttaggagtttgggaattatttatcccaggtcttgaagaa
ggaaccctgtataaatgggaaattgttagcgcttccggagaggtgcttatcaaaactgac
ccttatgggaaaagttttgatgctcctcctcatgcagtatctcgcgttgtgcatagtgat
cgctatacatggcatgacgcccagtggatggaaaaacgtaaaaacagagaagaccagcct
ttagcaatttatgaggtgcatgtaggttcatggcagtggcatgagggtaaacctttagga
taccgagagttagcaaagaaactcgctgcctattgcaaagagatgcattatacgcacgtt
gagctgttgccagttacagaacatcctttaaatgaatcttggggataccaagtaacagga
tactacgcacctacatttcggtatggatcacctgaagattttcagttttttgtagaccac
cttcatagtgaaaatatcggggtgattttagattgggtgcctgggcacttccccacggat
ggctttgctttagctcattttgacggagaagccctgtatgaatctatagaacataaagag
ccattacacccccattggcatacgtatacttttgattatcgctgcaatgaagtcgtgaat
ttccttttaggcagcgctctattttggttagataaaatgcacatagatggtttacgtgtc
gatgctgtaacctcgatgttgtatttagattatggccgtcaagaaggagagtggtccccc
aacatctatggaggtagagagaatctcgatgctatcgagttcttgaaacacttgaattct
gtagtgcatagggaattccccggggtatggacatttgctgaggaatctacagatttcccg
aacgtgaccaagccggtcgcccaaggagggttagggttcgattataaatggaacttaggt
tggatgcacgatacctttcgttatattcaggtcgatcctatgttccgttcgtatcaccat
aatgatctgacctttagcctttggtatgcctttaacgaaaggtacctccttcctctttct
catgatgaggttgtccatggtaaaggtagccttttacaaaaaatgcctggtgataatcca
tggacaaagtttgcccatatgcgtttgctgttaagctatcacatatgccagccgggcaag
aaactgctgtttatgggtggggaatttgctcaaggaaaagaatgggctccggatagctct
ttagattggcatctgttagataactcctatcacgcttgtttacacaggtgcgtagcacgg
atgaatgctttatattgtgaccttccttatttttggaaaggagatggtaagcaggagtct
ttccattgggtagacttcaaagatactgaaaataatgttatagcttactacagatttgca
ggagaaaatcgtagtagcgctttactgtgtatccaccattttagttcgggatattttcct
tcttacgttctacattgtcaggacataaatacctgccaactcctttttaatagcgatgat
atttgctttgggggttcagggaaaggcaaccgtcagccagttctttgcatagatcagcat
gtctcttggggggtggatatcgagctgccccctctagcaactttgattttttatgttcgt
tttgtaaataaacaatctcttgtttaa

DBGET integrated database retrieval system