KEGG   Chlamydia psittaci 84/55: B595_0751Help
Entry
B595_0751         CDS       T02308                                 

Gene name
recD_1
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpsb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740110..742314
Genome map
AA seq 734 aa AA seqDB search
MEKISGKLESVLFEDHDSKETAARMRIPYKGTMIVIKGQFPDSFLQLGMQLHVYGKWSEN
PNLGKYFQVYSCDSQEMRDNRGIINYLTSKLIKGIGPKITEKIIEKFRNDTADILDNQPE
RLIEIPGISQTRCDSLCEQLREQKNLRTTLLFLQQYNIAIHYGVKIYKKYKENSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLCAGIQYSLEELQEDGHTCYPLQSLAQ
LVEKLLNQDIPEKLIRIEEIISQVYIMQEKNLLHIEELENTPYVWVKHIYLAEKTVVSDL
KRILFSSRKIRPIDSDKAIQWVEENLSIHLEQNQKEAIRACFSEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHVIVIFIGDVHQLPSIGPGNILKDIINSKKITV
TKLNKIFRQVHDSNIIINAHKVNEGEFPVLYSESGRKDFLFFQKEDPQEAVDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGVLGIHNLNRVLKSALNPKQATLHGRFHSYAVGDKVMQI
RNNYNKEIFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIILPIHTSHFMMLYRNLLYTAITRGKQLVVLVGTKKAIAIATRNDKVQHRCTGLLQA
LEQLTQPQYQKHYH
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaagcgtgctttttgaagatcatgattcaaaggaa
actgctgcacgtatgagaataccctataagggtaccatgatcgttatcaaaggacaattc
cccgattcttttttacagctcggtatgcaactacatgtatacggaaagtggtcagaaaat
cccaacctagggaagtacttccaagtctatagttgtgattctcaagaaatgcgggataat
cgcgggataatcaactaccttacctctaaacttatcaaaggcattgggccaaaaatcaca
gaaaaaatcatcgagaaattccgaaatgacaccgcagatatcctcgataatcaacccgaa
agattaatagaaatccccgggattagccaaacacgctgtgatagtctctgtgaacaactc
cgcgagcaaaaaaatcttaggactactctactcttcctacaacagtacaacattgcgatt
cattacggtgtaaaaatctataagaagtataaagagaactctatagaaaaaatatgtgaa
gatccttttcttcttgctagagaaatggagggcatcggatttaaaactgctgatcttata
gcaacacgtcttggcgtgcctttaaactcacaaagccgattatgtgccggaatacaatat
tccctagaagaactccaagaagacggtcatacttgctaccccttacaaagtctggcgcag
ttagtagagaaactactcaatcaagatattccagaaaaactcatacgcattgaagaaatc
atttctcaagtgtacatcatgcaagagaaaaatcttcttcatatcgaagagttagaaaac
accccctacgtgtgggtaaaacatatttacctagcagaaaaaacagtagtttctgattta
aaacgtattttattttcctcaaggaaaatccgccctatagatagcgataaagccattcaa
tgggttgaggaaaacttaagtatacatttagagcaaaaccagaaagaagctattcgtgcg
tgtttttcagaaaaaattcatattattactggaggaccaggaacagggaaaagtaccatc
actaaggctatactcaagatatttgagcaagtgacttataaaatcattttagcagctcct
acaggaaaagctgcaaaacgcatgacagaaattactggaaaacactcggtaactatccat
gcactattacaatatgattttaaaacacggtcttttcgtaagaactacgaaaaccctata
gattgcgatctcatcattgtcgatgaatctggaatgatggatacctatcttttatatcat
ttcttaaaagctcttcctgatcatgtgatcgttatattcattggagatgtacaccaactt
cctagtatcggccctggcaatatcctaaaagatattatcaattctaaaaagattaccgtg
actaagctcaataagattttccgtcaggtccacgactctaacatcattatcaatgctcat
aaagtcaatgaaggtgagtttcctgtcctatattctgaatcaggccggaaagatttctta
tttttccaaaaggaagatcctcaagaagctgtagaccatattgtccatctagtgacacag
ttcatccctaagaaataccatatctatcccaaagatattcaaattcttgcgcccatgaaa
aagggggtcttaggaattcataatcttaatcgagtcctaaaatccgctttaaatcctaag
caggcaactctccacgggaggtttcattcctatgctgtaggagataaggttatgcaaatc
cgcaacaactacaataaagaaatatttaatggagatattgggtatatctctatgattaac
tttgaaaataaacgcgttgtagtgaatatggaaggaaagtatgtcgtctattccttctca
gagctggatgatttggttttagcctatgctacctcagtgcataaataccaaggaagtgaa
agtccgtgtattatcctccctatacacacttcacattttatgatgctttacaggaacctg
ctctacacggccatcacgagaggaaaacaactcgtagtcttagtcggaacgaaaaaagcc
attgctatagccacaagaaatgataaggtacaacaccgctgtacgggactcttgcaagct
cttgaacaacttactcagccccaatatcagaaacattatcattaa

DBGET integrated database retrieval system