KEGG   Chlamydia psittaci 84/55: B595_0898Help
Entry
B595_0898         CDS       T02308                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
cpsb00020  Citrate cycle (TCA cycle)
cpsb00640  Propanoate metabolism
cpsb01100  Metabolic pathways
cpsb01110  Biosynthesis of secondary metabolites
cpsb01120  Microbial metabolism in diverse environments
cpsb01130  Biosynthesis of antibiotics
cpsb01200  Carbon metabolism
Module
cpsb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B595_0898 (sucC)
   00640 Propanoate metabolism
    B595_0898 (sucC)
   00660 C5-Branched dibasic acid metabolism
    B595_0898 (sucC)
Enzymes [BR:cpsb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B595_0898 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFS19851
Position
complement(898252..899412)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYNIAIPPYRVASSVEEGRHTLNELGISAGVVKVQVHAGGRGKNGGV
IVAKSPDEILAAVDKLLRMRFTSNQTSGEALPVEKVLITPLVNIATEYYLAVIMDRKNRC
PAIMLSRAGGVDIEEVAQKYPDQLLTIPLTPFARIYNYQLRQMIKFMGWEGDTGKQGVQL
IKSLVQCFYDNDASLLEINPLVLTQEGDLLVLDAKVTIDDNALYRHPKLEVLYDPSQENV
RDVLAKQIGLSYIALDGNIGCLVNGAGLAMSTLDILKIHGGSAANFLDVGGSATEQQIQE
AVSLVLSDENVEVLFINIFGGIMDCSAVASGLVAVMQTRENLIPTVVRLEGTNVELGKEI
VQRSGIPCKFTDSLNTGAQLAVALSK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaataccaagctaaagacctcttagcctcttataatatagctattcct
ccttatcgtgtagcctcgtctgttgaagaaggtagacatacgctcaatgagttaggaatc
agcgcaggtgtggttaaagtacaagtacatgctggaggtagggggaaaaacggtggtgtc
attgttgcgaaatctcctgatgagattcttgcagctgtggataaattgttacgcatgcgt
tttaccagtaatcaaacttctggagaagctttacctgtagagaaagttctgatcacaccc
ttagtgaatattgctactgagtattacctagcagtaatcatggataggaaaaatcgctgc
ccagcgattatgttatcgagagccggaggtgttgatattgaagaggtagctcaaaaatat
cctgaccaattgcttactatacccctgactccttttgctcgtatatataattatcaactt
agacagatgattaaatttatgggttgggaaggcgatacagggaaacaaggcgtacagctg
attaaaagtcttgttcaatgtttctatgataatgacgcttctttactggaaattaatcct
ttagtgcttactcaagaaggagatcttcttgtactagatgctaaagtcactattgatgat
aacgccttataccgtcatccaaaacttgaagtattgtacgacccttctcaagaaaatgtt
cgtgatgtacttgctaagcagataggactttcctacattgctctagatggcaatattggg
tgcttagttaatggtgccggattagctatgagcacattagacattcttaagattcatgga
ggatctgcagcaaatttccttgatgtaggcgggagcgctacggaacaacaaattcaggaa
gccgtatctttagtgctatcagacgaaaatgtagaggttctttttatcaatattttcggt
ggcattatggattgttctgcagttgcctcgggacttgttgctgtgatgcaaactagggaa
aatctcattcctacagtagtgcgtttagaaggaacaaatgtagaacttggcaaagaaatt
gtacagcgttcaggaatcccctgtaaatttaccgattccttaaatacgggcgcacagctt
gctgtagcattaagtaaataa

DBGET integrated database retrieval system