KEGG   Chlamydia psittaci 84/55: B595_1145Help
Entry
B595_1145         CDS       T02308                                 

Definition
dihydrofolate reductase family protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpsb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpsb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157326..1157769)
Genome map
AA seq 147 aa AA seqDB search
MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN
VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI
KGWRKTVLDEKENLTFCFYENFADCHS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa
actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag
tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat
gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt
cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt
ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc
aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa
aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system