KEGG   Chlamydia psittaci 84/55: B595_1152Help
Entry
B595_1152         CDS       T02308                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B595_1152 (recD)
Enzymes [BR:cpsb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B595_1152 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1164034..1165548)
Genome map
AA seq 504 aa AA seqDB search
MLSLSPDVSHLLYDVVQQQIVLPLDLAFAKRHISPESKKAFAFLAISSALWRCGYPFLSI
ENERLFPSVSGISEKLFYEYFQALPHDVLSSLFVIENNKIYLKSLYTVREKLFKKLSLLS
QASNRYSLTTTTLSSLSQEQNEVFHKAVNSCFSLICGGPGTGKTFLAVQIIIALIKQYPK
IRIAIVSPTGKATSHIRHILSKHHISESSVTIQTIHRFLQEHAYHQCASFDLLLVDEGSM
VTFSLLHSLVNTLSGENKHGKIIADNLIILGDENQLPPIGVGAGNPLQDLIARFPERALH
LHVSHRAKTNRVQNFARAVLERQAIPFTPLPPLLTALSMIKEAFINTPSSQTQLCVLTPM
RHGPWGYLRLNELLFHEIQKTHPELPIPIMITERYEAWGLFNGDTGYLCPKTQKLFFSHS
RFIDAKEFSYYTYNYAMSVHKSQGSEYEDVIVIIPKGCETFDISILYTAITRAKNNIDVW
ADRETLYKIIKKPHKYTYGVDRLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgttaagcccggatgtttctcaccttctttatgatgtagttcaacaacagatt
gttctacctttggacctagcttttgcgaagcgccatatctctccagaatcaaaaaaagcg
tttgcatttctggctatttcttctgctctttggcgttgtggttatccctttcttagtata
gaaaatgagcgtttattcccttcagtatccggaatttctgaaaagctgttttatgaatat
tttcaggctcttcctcacgatgttttgtcgtcgttgtttgtgatagaaaataataaaatt
tatttaaaatctttatatacagttcgtgagaaactttttaaaaaactctctttgttgtca
caagcttctaatcggtacagcctgactacaacaactctgtcgagtttatctcaggagcaa
aatgaggtttttcacaaagctgttaacagttgtttttctttgatctgtggtgggccggga
acagggaagacatttcttgctgtacagataatcatcgcgttaattaagcagtatcctaaa
atccgtattgctatagtctctcctacaggaaaagcaacctctcatatccgtcacatactc
tctaaacatcatatttctgagtctagtgtcacaatccaaacaatacaccgattcttgcaa
gaacatgcgtatcaccagtgcgcttcttttgatttattattagttgatgaggggtctatg
gtgacatttagtcttctgcatagcctagtcaacactttatcaggggaaaataaacacggg
aaaatcattgctgataatttaattatattgggagatgagaatcagctcccccccataggt
gttggcgccggaaatcctcttcaagatttgatagcacgtttccctgaaagagctctacat
cttcatgtttctcacagagctaaaacaaatagagttcaaaattttgctagagctgtttta
gaaagacaagccattccttttacccctttgcctcctttgctcactgcactttctatgatt
aaagaggcgtttataaataccccctcatctcaaacacaattgtgtgttttaactcctatg
cgacatggtccttggggatacctacgcttaaatgaactgctctttcatgaaatacaaaaa
acacatccagagttacccattcctattatgataacagaacgttatgaagcttgggggcta
tttaatggtgatacggggtacctttgcccaaagacgcaaaagttatttttttctcactct
cgctttatcgatgccaaagagttttcttattatacctataactacgctatgtcagtgcat
aaaagtcagggaagtgagtacgaggacgtcattgttattatccctaaagggtgtgaaact
tttgacatttctattctttacacagcgatcacacgtgcaaagaacaacatagatgtgtgg
gctgatcgagagacgttgtataagatcataaaaaaaccccataagtatacttatggggta
gatcgtcttctttag

DBGET integrated database retrieval system