KEGG   Chlamydia psittaci CP3: B711_0307Help
Entry
B711_0307         CDS       T02251                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpsc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287427..289610
Genome map
AA seq 727 aa AA seqDB search
MVERIVNSEDVSLLISGRQSNPHKFLGIVSENSSQDRIILFRPGAHSVVVELQGNIAHAQ
HHHSGIFSLTAPKGTLPQDYRIYHQNGLLAHDPYAFSPLWGEVDSFLFHQGTHYKIYERM
GAIPYDVQGISGVLFVVWAPHAQRVSVVGDFNFWNGLVNPLRKVSDLGVWELFIPGLEEG
TLYKWEIVSASGEVLIKTDPYGKSFDAPPHAVSRVVHSDRYTWHDAQWMEKRKNREDQPL
AIYEVHVGSWQWHEGKPLGYRELAKKLAAYCKEMHYTHVELLPVTEHPLNESWGYQVTGY
YAPTFRYGSPEDFQFFVDHLHSENIGVILDWVPGHFPTDGFALAHFNGEALYESIEHKEP
LHPHWHTYTFDYRCKEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRQEGEWSPN
IYGGRENLDAIEFLKHLNSVVHREFPGVWTFAEESTDFPNVTKPVAQGGLGFDYKWNLGW
MHDTFRYIQVDPMFRSYHHNDLTFSLWYAFNERYLLPLSHDEVVHGKGSLLQKMPGDNPW
TKFAHMRLLLSYHICQPGKKLLFMGGEFAQGKEWAPDSSLDWHLLDNSYHACLHRCVARM
NALYCDLPYFWKGDGKQESFHWVDFKDTENHVIAYYRFAGEDRSSALLCIHHFSSGYFTS
YVLRCQDINTCQLLFNSDDICFGGSGKGNRQPVLCIDQHVSWGVDIELPPLATLIFYVRF
VNKQSLV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaggattgtcaactctgaagacgtgtccttattaatttctggaaggcagagt
aatcctcataagtttttagggattgtttctgaaaactcctcacaggatagaatcattctc
tttcgtcctggggcccattctgtagttgtcgaactgcagggaaatatagcgcatgcacaa
caccatcattcggggatattttctctaactgctcctaaggggactctccctcaggattat
cgtatctatcatcaaaatggcctattagctcacgatccttatgcgttttctcctttgtgg
ggagaagtagattcttttttatttcatcaaggtacgcactataagatttacgaacgtatg
ggagcgattccctatgatgttcagggaatttccggggtgctttttgtggtttgggctcca
catgcacaacgcgtatctgttgtcggtgattttaatttttggaatggtcttgttaatcct
ttgcgcaaagtctctgatttaggagtttgggaattatttatcccaggtcttgaagaagga
accctgtataaatgggaaattgttagcgcttccggagaggtgcttatcaaaactgaccct
tatgggaaaagttttgatgctcctcctcatgcagtatctcgcgttgtgcatagtgatcgc
tatacatggcatgacgcccagtggatggaaaaacgtaaaaacagagaagaccagccttta
gcaatttatgaggtgcatgtaggttcatggcagtggcatgagggtaaacctttaggatac
cgagagttagcaaagaaactcgctgcctattgcaaagagatgcattatacgcacgttgag
ctgttgccagttacagaacatcctttaaatgaatcttggggataccaagtaacaggatac
tacgcacctacatttcggtatggatcacctgaagattttcagttttttgtagaccacctt
catagtgaaaatatcggggtgattttagattgggtgcctgggcacttccccacggatggc
tttgctttagctcattttaacggagaagccctgtatgaatctatagaacataaagagcca
ttacacccccattggcatacgtatacttttgattatcgctgcaaagaagtcgtgaatttc
cttttaggcagcgctctattttggttagataaaatgcacatagatggtttacgtgtcgat
gctgtaacctcgatgttgtatttagattatggccgtcaagaaggagagtggtcccccaac
atctatggaggtagagagaatctcgatgctatcgagttcttgaaacacttgaattctgta
gtgcatagggaattccccggggtatggacatttgctgaggaatctacagatttcccgaac
gtgaccaagccggtcgcccaaggggggttggggttcgattataaatggaacttaggttgg
atgcacgatacctttcgttatattcaggtcgatcctatgttccgttcgtatcaccataat
gatctgacctttagcctttggtatgcctttaacgaaaggtacctccttcctctttctcat
gatgaggttgtccatggtaaaggtagccttttacaaaaaatgcctggtgataatccatgg
acaaagtttgcccatatgcgtttgctgttaagctatcacatatgccagccgggcaagaaa
ctgctgtttatgggtggggaatttgctcaaggaaaagaatgggctccggatagctcttta
gattggcatctgttagataactcctatcacgcttgtttacacaggtgcgtagcacggatg
aatgctttatattgtgaccttccttatttttggaaaggagacggtaagcaggagtctttc
cattgggtagacttcaaagatactgaaaatcatgttatagcttactacagatttgcagga
gaagatcgtagtagcgctttactgtgtatccaccattttagttcgggatattttacttct
tacgttctacgttgtcaggacataaatacctgccaactcctttttaatagcgatgatatt
tgctttgggggttcagggaaaggcaaccgtcagccagttctttgcatagatcagcatgtc
tcttggggggtggatatcgagctgccccctctagcaactttgattttttatgttcgtttt
gtaaataaacaatctcttgtttaa

DBGET integrated database retrieval system