KEGG   Chlamydia psittaci CP3: B711_0363Help
Entry
B711_0363         CDS       T02251                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00010  Glycolysis / Gluconeogenesis
cpsc00051  Fructose and mannose metabolism
cpsc01100  Metabolic pathways
cpsc01110  Biosynthesis of secondary metabolites
cpsc01120  Microbial metabolism in diverse environments
cpsc01130  Biosynthesis of antibiotics
cpsc01200  Carbon metabolism
cpsc01230  Biosynthesis of amino acids
Module
cpsc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B711_0363 (tpiA)
   00051 Fructose and mannose metabolism
    B711_0363 (tpiA)
   00562 Inositol phosphate metabolism
    B711_0363 (tpiA)
Enzymes [BR:cpsc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     B711_0363 (tpiA)
Exosome [BR:cpsc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   B711_0363 (tpiA)
  Exosomal proteins of bladder cancer cells
   B711_0363 (tpiA)
  Exosomal proteins of melanoma cells
   B711_0363 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFS26767
Position
361063..361827
Genome map
AA seq 254 aa AA seqDB search
MERKRYIFGNWKMHKTAKEAKDYLSVFCPLLEEVAPVSRVGITPAFTALHACCESIKSFH
SPLWLGAQNVHQDTSGAFTGEISLPMLKEFDVNFVLLGHSECRHIFHEEDTTIALKVGAA
ASEGIIPVLCIGETLEVREKGATEAMLSNQLMLGLAQLPETASVIIAYEPVWAIGTGKVA
SAVDVQEAHAFCREVLANIFSKEKAEEISILYGGSVKADNAEGFARCPDVDGLLVGGASL
DPKVFADVVANFHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaagcgttatattttcggtaattggaaaatgcataagacagctaaagaggct
aaagattatttgtctgttttctgccctctccttgaagaagttgctcctgtatctcgtgtg
ggtatcacccccgcattcacagcgttacatgcttgctgtgaatctataaagtcttttcac
agtcctctgtggctgggagcgcaaaatgtccatcaggatacctcgggagcctttacaggt
gaaatttccttgcctatgctcaaagaatttgatgtcaattttgtacttttaggtcactcc
gaatgccgtcatatttttcatgaagaagatacgaccattgcgcttaaggttggtgccgca
gctagtgaaggcattattcccgttctgtgtatcggagaaactctagaagttagagaaaaa
ggcgcgacggaagctatgttatctaaccagttgatgttggggcttgcgcaacttccggaa
actgcctctgtaatcattgcttatgaacccgtatgggcaattggtacgggtaaagtagct
tcagcggttgatgtgcaagaggcacatgccttttgtcgagaggtgcttgcgaatatattt
tccaaagagaaagctgaggagatttccattctttatgggggatctgtaaaggcagataat
gctgaaggatttgctcgttgtcctgatgtagacgggttgttagtaggaggcgcttcctta
gatcctaaagtttttgccgatgttgtcgcgaattttcatcgttag

DBGET integrated database retrieval system