KEGG   Chlamydia psittaci CP3: B711_0789Help
Entry
B711_0789         CDS       T02251                                 

Gene name
atpB
Definition
(GenBank) V-type ATP synthase beta chain
  KO
K02118  V/A-type H+/Na+-transporting ATPase subunit B
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00190  Oxidative phosphorylation
cpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    B711_0789 (atpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N
Motif
Other DBs
NCBI-ProteinID: AFS27182
Position
complement(783992..785308)
Genome map
AA seq 438 aa AA seqDB search
MQTIYTKITDIKGNLITVEAEGARLGELAEIERVDGRSSYASVLRFDAKTVTLQVFGGTS
GLSTGDRVVFLGRSMEVTYGDSLIGRRLNGVGKPIDGEGECFGDPIEISTPTFNPVCRVV
PRDMVRTNIPMIDVFNCLVKSQKIPIFSSSGENHNALLMRIAAQTDADIVIIGGMGLTFV
DYSFFVEESKRLGFADKSVMFIHKAVDAPVECVLIPDMALACAEKFAVDQNKNVLVLLTD
MTAFADALKEIAITMDQIPANRGYPGSLYSDLALRYEKAVDIAQGGSITLISVTTMPGDD
ITHPVPDNTGFITEGQFYLKNNRIDPFGSLSRLKQLVIGKVTREDHGDLANSLIRLYADS
RKANERMSMGFKLSNWDKKLLAFAELFETRLMSLEVNIPLEEALDIGWKILAQSFHSEEV
GIKEQLINKYWPKSCLHR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaatatatacaaaaattaccgatatcaaaggaaacttgataaccgtagaagct
gagggagcacgtttaggcgaattagcagaaatagaaagagtagatggaaggtcttcgtat
gcctcggttttgcgtttcgatgctaagacagtgactctacaagtctttggagggacttct
gggctgtcaacaggagaccgagtggtgtttttaggacgctctatggaggtgacttacgga
gactctttaataggtaggcgtttgaacggggtaggtaaacctattgacggtgagggagaa
tgttttggtgatccgattgaaatatcaacacctacattcaatcctgtttgccgtgttgtt
cctagggatatggtgcgcaccaatattcctatgattgatgtattcaattgcttagtgaaa
tcacaaaaaattcctattttctcgtcttcaggtgagaatcacaacgccttattgatgcgt
atagcagcacaaacagatgcagatatcgtaattattggaggcatgggattaacctttgtt
gattatagcttttttgttgaggagtctaaaaggttaggttttgctgataaaagtgtaatg
tttattcataaggctgtagatgctcctgtagagtgtgtattgattcctgatatggcctta
gcatgtgctgaaaaatttgccgtagatcaaaataaaaatgttttagtcttacttacagat
atgacggcatttgcagatgctttaaaagaaattgctattaccatggaccaaattcctgca
aaccgcgggtatcctggatctttgtattctgatcttgctttacgctatgaaaaggctgtg
gacatagcccagggtggatcgattaccttaattagtgtaactacgatgcctggtgatgat
attacgcatcctgttcctgataatacaggattcattacggaagggcaattttacctgaaa
aataatcgtattgatcctttcggttccttatctcgtttgaaacaattggttattggtaag
gtgaccagagaagatcacggagatctagcaaattcattaatacggctttatgctgattct
agaaaagctaatgaaagaatgtccatgggctttaagttatccaattgggataaaaagtta
ttggcatttgcagagctttttgaaacacgattgatgagtttagaagtaaatattccttta
gaagaagctttggatattgggtggaaaattcttgctcaaagtttccattccgaagaagta
ggaataaaggaacagttgatcaataagtattggcccaagtcatgtcttcacaggtaa

DBGET integrated database retrieval system